HOG Organism Gene ID Name Annotation
aHOG1856 hbo HBOR09000 Hbor_09000 predicted membrane protein, COG4347
aHOG1856 hla HLAC0981 Hlac_981 hypothetical protein
aHOG1856 hwa HQ2780 hypothetical protein
aHOG1856 hma Hma_13449 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


981|hp|hla        ----MTRSDTSDWLRSLGRLRRAAVRRRVRDAIAEELLGTPRSLAVVLGFTAFMLAVGIG
13449|hp|hma      ----MSEQ------------RGPLPRRYAR-----YYLEQTPSLVWLLVVNAVAMLVGVR
9000|hp|hbo       ----MDDATTEGTTGT--TLRRPIPERWVQ-----YYLGNGPSLAWLLVVNAAAFLVGVS
2780|hp|hwa       MMSASEDDGVAQSRGWHGRLPQPFPTRWVR-----YYLTRPASLGWLLIADGVAFLVGVN
                                        .   * ..       *    **  :*   .  : **: 

981|hp|hla        YYA---PTAGEVPVALWPLYADSAVAVALGGIALLSLVPTVR--RGDSVTDAPTSRGLAY
13449|hp|hma      FYVETMP---EVSTFLWPLYADSPAALFLMTLSVATLLPFLG----KSLDEVPLTVPLAY
9000|hp|hbo       FYVHSDPSLRDVSSLLYPLFGDSPTALALGTLSLATLLPHLG----NRVRDAPTNYPLTV
2780|hp|hwa       FYVHSDPSLQAVSPLLYPLFGDSPTALALASLSVATILPFVRCTQLQPLANIPSNHLVSI
                  :*.   *    *.  *:**:.**..*: *  ::: :::* :     . : : * .  :: 

981|hp|hla        LQTVAFVWLVQFGLWPLISLNLAFGEYVA-APDAWIYYWGVLGTHLCFVGLALLFPAFGR
13449|hp|hma      LHTIALVWLVKMGLWTVVALNIGFDAYFP-AP---WAYFGIIITHLGFVAEGLLVPHYAR
9000|hp|hbo       IHTLAFVWLVKYGVWTVVALNLRPDLYFGFTPDLLWDYWGIMLTHLFFLVEALLIPYYGK
2780|hp|hwa       LHTLAFVWLIKYGLWTGIALNLRPDLYIGFTPALLWEYWGILLTHAFFILQAMAIPYYGE
                  ::*:*:***:: *:*. ::**:  . *.  :*     *:*:: **  *:  .: .* :. 

981|hp|hla        TTRGALGLALALAVGNVALDYGAGYHPPLLYEPGLLLAGATLAIGVGSVWLANRSFRRL-
13449|hp|hma      TTKGALVTALVLALANDVLDYGFGYHPPLRYDPGVVLPLATVALSVLSVGIVWRLLPMQ-
9000|hp|hbo       TTRSALALALALAFVNDVYDYGFGFYPPLKYEAGVLLTAITIALSVLSVALAAWLFDRQE
2780|hp|hwa       TSRTALFIAFTLLLINDAFDYGLGLYPPLRYEAGMMLAVITVGLSIVVVLLAADAFDHH-
                  *:. **  *:.* . * . *** * :*** *:.*::*.  *:.:.:  * :.   :    

981|hp|hla        -----------DENI
13449|hp|hma      --------VPSKKTA
9000|hp|hbo       SNTMRTDAVSAAERQ
2780|hp|hwa       --------TTVQSSD
                              .