HOG Organism Gene ID Name Annotation
aHOG1852 hbo HBOR16320 Hbor_16320 theronine dehydrogenase-like Zn-dependent dehydrogenase( EC:1.2.1.46,EC:1.1.1.1 )
aHOG1852 hla HLAC1837 Hlac_1837 Alcohol dehydrogenase GroES domain protein
aHOG1852 hwa HQ3187 fdh formaldehyde dehydrogenase
aHOG1852 hma Hma_7314 adhC formaldehyde dehydrogenase
MUSCLE (3.6) multiple sequence alignment


16320|gene|hbo      --MKAVVYQGPNEVAVEDVDEPELEHPNDVIIDITTTAICGSDLHMYEGRTAAEPGIVFG
1837|gene|hla       --MRAVVYQGPYDVAIEEVDDPEIEHPNDVVIDITTSCICGSDLHMYEGRTAAEEGIVFG
3187|gene|hwa       MSMEAVVYQGEKDVAIESVDEPEIEHPNDVIIDITTTCICGSDLHMYEGRTAADPGIVFG
7314|gene|hma       MSMNAVVYKGPKEVAVEEVDEPEIEHPNDVLIDITTSCICGSDLHMYEGRTAAEPGIVFG
                      * ****:*  :**:*.**:**:******:*****:.***************: *****

16320|gene|hbo      HENMGVVTEVGEGVSTLKEGDRIVAPFNVACGFCKNCEEGYTGFCTNVNPGFAGGAYGYV
1837|gene|hla       HENMGIVSEVGEAVSTLEEGDRVVMPFNVSCGFCQNCEEGYTGFCTNVNPGFAGGAYGYV
3187|gene|hwa       HENMGIVTEVGDAVSGLEEGDRVVAPFNVACGFCENCEEGYTGFCTNVNPGFAGGAYGYV
7314|gene|hma       HENMGIVTEVGEAVSSLEEGDRVVAPFNVACGFCENCEAGYTGFCTNVNPGFAGGAYGYV
                    *****:*:***:.** *:****:* ****:****:*** *********************

16320|gene|hbo      AMGPYKGGQAEKLRIPYADFNALKLPEGGANEDSFALLADIFPTGWHGTELAGLKPGESI
1837|gene|hla       AMGPYPGGQAEKLRVPYADHNALKLPEGDEHEDAFSLLADIFPTGWHGTELANLQPGESV
3187|gene|hwa       AMGPYTGGQAEKLRIPYADFNALQLPDGDEHEDAFSLLADIFPTGWHGTELADIQPGDSI
7314|gene|hma       AMGPYKGGQAEKLRIPYADFNALKLPDGDEHEDAFSLLADIFPTGWHGTELANLEPGDSV
                    ***** ********:****.***:**:*. :**:*:****************.::**:*:

16320|gene|hbo      AIYGAGPVGLMAAYSAKIKGASEIFVVDRVPSRLELAEKHCDATAINFEDGNPVEQITDA
1837|gene|hla       AIFGAGPVGLMAAYSAKIKGAAEIYVVDQVPSRLELAEENCDATAIDFSEGDPVDQIIEE
3187|gene|hwa       AIYGAGPVGLMAAYSAKVKGAAEIYTVDRVPSRLELAEEHCDATAINFEEGNPVEQIKDI
7314|gene|hma       AIYGAGPVGLMAAYSAKIKGAAEIYSVDRVPSRLELAEEHCDATPINFEDGNPVEQIKAQ
                    **:**************:***:**: **.*********::****.*:*.:*:**:**   

16320|gene|hbo      HGGEVDRGVDAVGYQAVDPERAR-EADDDPYDPARENPAVVLNQLIRTVRPTGQLGIPGL
1837|gene|hla       HGGMVDKGVDAVGYQATDPEDVDTESEDYSYDPAKENPAVVINSLIRVVRPTGELGIPGL
3187|gene|hwa       HGGGVDKGVDAVGYQAVDPD----KEGDSAYDPARENPAVVINNLIRTVKPTGQLGIPGL
7314|gene|hma       HGGGVDKGVDAVGYQAIDPD----KEADDAYDPARENPAVVINNLIRTVKPTGELGIPGL
                    *** **.********* **:    :  * .****.******:*.***.*.***:******

16320|gene|hbo      YVPSDPGAPDEMAAEGRLGIDFGKLFEKGQRLGTGQCNVKDHNRELRDLIIEGRADPSWV
1837|gene|hla       YVPEDPGAPDDMAAQGRLGIDFGKFFEKGLKCGTGQCNVKSYNRYLRDMIIEGRADPSWV
3187|gene|hwa       YVPEDPGAPSEMAAQGRLGIDFGLLFEKGQALGTGQCNVKEYNRELRDLIIEGRADPSWV
7314|gene|hma       YVPEDPGAPDDMAAQGRLGIDFGLLFEKGQALGTGQCNVKSYNRELRDLIVEGRADPSWV
                    ***.*****.:***:******** :****   ********.:** ***:*:*********

16320|gene|hbo      VSHRVGLEEAPEMYEKFDKREEGVTKVLLEP
1837|gene|hla       VSHRVNLDEAPEMYEAFDAREEGVTKVLLEP
3187|gene|hwa       VSHRVGLEEAPEMYERFDNREEGVTKVLLEP
7314|gene|hma       VSHRVGLEEAPEMYEAFDNREEGVTKVLLEP
                    *****.*:******* ** ************