HOG Organism Gene ID Name Annotation
aHOG1851 hbo HBOR37900 Hbor_37900 hypothetical protein
aHOG1851 hla HLAC0289 Hlac_289 threonine dehydratase
aHOG1851 hwa HQ1762 ilvA threonine dehydratase
aHOG1851 hma Hma_7371 ilvA3 threonine dehydratase
MUSCLE (3.6) multiple sequence alignment


37900|hp|hbo       ----------------MAGDEV------PDVEAGTEELLDEA----EEIDSDDGMTARMR
289|gene|hla       MKPIRLRSATESFSGIPENTALMSSVTIADVEAAAARLEPAAIVQRTPVERSRSLSERCG
1762|gene|hwa      MTSAPPGTDGNRSNGNNAEKTL--PITYSDIEQARERLNDETVVKSTPVEISTSLGDLVD
7371|gene|hma      -------------MTHTESDTL--PVTYADIERARERLDDDTVVKKTPVERSSSLGGFVD
                                        :      .*:* .   *   :      :: . .:     

37900|hp|hbo       RENQLLGRAVDYVAAWSEDGAISSANANALADAL--------ASELAHYTKTDIKDEFTD
289|gene|hla       ADVRLKMEHLQRTGSFKTRGAY-----NAISRAVEQAAERADESELDRVVAASAGNHAQG
1762|gene|hwa      AEVYLKMEHLQWTGSFKTRGAY-----NKISQAV--------RAGANRFIAASAGNHAQG
7371|gene|hma      AEVYLKMEHLQWTGSFKTRGAY-----NKISQDV--------ADDVESFVAASAGNHAQG
                    :  *    :: ..::.  **      * ::  :                 :.  :   .

37900|hp|hbo       V-FVDDGSGANGIPFDELIEQRLQEVKVVSTTDAKQGLVWRWH-FSDGVQLETEKSKDEG
289|gene|hla       VALAASGTGIDATIV---MPESAPAAKIEATRGYGAEVVLRGSAFPEAMAHAQTLIDDPG
1762|gene|hwa      VALAATKCDANATIY---MPESAPQAKVDATRSYGATVELIGTDFQETMAHAKEAVEESD
7371|gene|hma      VALAATKCGAESTIF---MPENAPQAKIDATRAYGGSVELVGNDFQETMSHAKAVVEETD
                   * :.    . :.      : :    .*: :*      :      * : :       .: .

37900|hp|hbo       RKHYDWTAWKEDYFEALISLGKGERIAPPSRERRDSN---------DWKEFLSEILLDRA
289|gene|hla       TR------FVHAFDDPDVVAGQGTLGLEVLDQVPDVDTVLVPVGGGGLAGGVATAIKARS
1762|gene|hwa      AK------FVHAYDDLDIIAGQGTLGIEMYHNKPDADTIIVPIGGGGLISGVSTAIKHLS
7371|gene|hma      AE------FVHAYDDLDIIAGQGTLGTEMYHDCPDVDTVIVPIGGGGLISGVSTAIKHLS
                           :   : :  :  *:*        :  * :         .    ::  :   :

37900|hp|hbo       ETVEHVGPRTEAVEHLRDYVNR--QTAYADVKDMRDRQGIWMDAPPAD---------DDG
289|gene|hla       PETRVIGVQTEGASTLSESLAAGELVTREEPDTIAD--GIATGGLSELTFGLLKEHLDDV
1762|gene|hwa      PSTRIIGVQATGAETVHESLDKGIPVTLDEVNTIAD--GIATGGISARTLQLIEANVDEV
7371|gene|hma      PETRVIGVQATGAETVHESLDKGIPVVLDEVDTIAD--GIATGGISETTLDIIEANVDEV
                     .  :* .: ... : : :     ..  : . : *  **  .. .           *: 

37900|hp|hbo       EAATDGGGPSQIRVPTQAVKRICDQAGIETRALQIE------LDARSETLPDVAGVSDYE
289|gene|hla       VVVSDDDVAAAILLLLERAKQMIEGAGATAAATLLNDDALDELDLAGETVVPLLCGGNID
1762|gene|hwa      VTVSDTEIARAILLLMKRAKQVVEGAGAASVAALLSSD----VDVRGETVMPLLCGGNLD
7371|gene|hma      VTVSDTDIAQAILLLMERAKQVVEGAGAASVAAILSDS----LDVSGETVMPLLCGGNLD
                    ..:*   .  * :  : .*.: : **  : *  :.      :*  .**:  :   .: :

37900|hp|hbo       YVDGQRVSFWCLDAGFAEPAEFVEEPESPAEQAAREQEEEAEEAQTDVGAVDDKDDSDGT
289|gene|hla       VTTLKEVVTHAL-----------VERDQLIELAVRIDDTPGTMGEISTLIGAERANIRTV
1762|gene|hwa      MTGLQTVLVHAL-----------TQRSQRIRLRVRIDDRPGKMADISGIIADQRANIHNV
7371|gene|hma      MTQMREVLIHAL-----------TERQQLLQLRVRIDDQPGVMEEISGVIARQGANIHDV
                    .  . *  ..*            : ..     .* ::  .   : .     :  :   .

37900|hp|hbo       ESEQETDDVT-EDGDEGDEDAHDGPATSDETESAEDDVDGHTEDERPPEDAPDDGPANDF
289|gene|hla       RHERSRPDLPVGDADLVFEVETNGPAHVDRV------LKAVREAGYEVEWTTQEG-----
1762|gene|hwa      RHDRSVANLAVGEAYLVFTVEASGAEHTATI------VDAIESAGYPVQDVTRSA-----
7371|gene|hma      RHERSVENLEIGEAYLVFNVETSGAEHAQSI------ITAIRDAGYPVDNVAREAKSGAL
                     :..  ::   :.        .*.            : .  .     : .. ..     

37900|hp|hbo       ESGITGGFGIDPDDDDEGGE
289|gene|hla       --------------------
1762|gene|hwa      --------------------
7371|gene|hma      --------------------