HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0185COG0591KOG2348arCOG01316Na+/proline symporterpantothenate permease

HOG Organism Gene ID Name Annotation
cHOG0185 nrc1 VNG1785 panF pantothenate permease
cHOG0185 hmu HMUK1541 Hmuk_1541 Na+/solute symporter
cHOG0185 hma RRNAC1726 panF pantothenate permease
cHOG0185 hwa HQ3326A panF sodium/pantothenate symporter
cHOG0185 hla HLAC2133 Hlac_2133 Na+/solute symporter
cHOG0185 hbo HBOR07370 Hbor_07370 Na+/proline symporter
cHOG0185 hut HUTA0201 Huta_0201 Na+/solute symporter
cHOG0185 hvo HVO_2324 HVO_2324 panF pantothenate permease
cHOG0185 nph NP4534A tp08 sodium/proline symporter, sodium/pantothenate symporter
cHOG0185 hhi 2258 panF pantothenate permease
MUSCLE (3.6) multiple sequence alignment


4534|gene|nph       ---MTATLQVTIVVGYLLVALAIGLLAYRVTERAAEDFYLASRTFGTAVLLFTVFATLLS
201|gene|hut        --MANVALQLGIVVGYLLLALGVGLVAYRLTERSAEDYYLANRTIGTVVLLFTTFATLLS
1785|gene|nrc1      ----------------MVVALAVGLVAYRVTDRDAEDYYLAGRGLGTGVLLFTTFATLLS
2133|gene|hla       ---MTLSLSLGIVVGYLLFALAVGLVAYRVSEATAEDYYLANRSIGTVVLLFTTFATLLS
11726|gene|hma      ----------------MVVALAVGAVAYRLTERTAEDYYLASRTLGTVVLLFTTFATLLS
2258|gene|hhi       --MADTALQLGIVGAYMVVALAVGAVAYRLTERTAEDYYLASRTLGTVVLLFTTFATLLS
3326|gene|hwa       MAESAIGIELGVVAAYLVLALSVGIVGYRLTGSDAEDYYLASRSLGTIVLLFTTFATLLS
2324|gene|hvo       -MVSALGIQLGVVGAYLVVALAVGLLAYRLTSRDAEDYYLAGRSIGTVVLLFTTFATLLS
7370|gene|hbo       MAESDLLVQMGVVGVYLVVSLLVGFVAYRLTSRDAEDYYLASRSLGTVVLLFTTFATLLS
                                    ::.:* :* :.**::   ***:***.* :** *****.******

4534|gene|nph       AFTFFGGPDNAYAFGPEWILVMGLMDGLIFAILWYLIGYKQWLLGQRHGYVTLGEMFGDR
201|gene|hut        AFTFFGGPNLAFAAGPEWILVMGLMDGVIFGILWYVMGYKQWLIGREYGYVTVGEMLGDR
1785|gene|nrc1      AFTFFAGPNIAYANGPEWILVMGLMDGVLFGLLWYVLGYRQWLLGKANGYVTLGEMLGDR
2133|gene|hla       AFTFFGGPNLAFAAGPEWLIVMGTLDGVLFAVLWYAIGYRQWLIGDRHGYVTLGEMLGDR
11726|gene|hma      AFTFFGGPNLAFSAGPEWILVMGLMDGIIFAVLWYVLGYKQWLVGKRHGYVTLGEMLGDR
2258|gene|hhi       AFTFFGGPNLAFSAGPEWILVMGLMDGIIFAVLWYVLGYKQWLVGKRHGYVTLGEMLGDR
3326|gene|hwa       AFTFFGGPNLTYGAGPEWILVMGLMDGILFAILWYVIGYRQWLVGERHGYVTLGEMLGDR
2324|gene|hvo       AFTFFGGPDLAYRAGPEWILVMGVMDGVLFAILWYVVGYKQWLVGRAHGYVTLGEMLGDR
7370|gene|hbo       AFTFFGGPNLAYGAGPEWILVMGLMDGVLFAVLWYAVGYRQWLIGQNRGYVTLGEMLGDR
                    *****.**: ::  ****::*** :**::*.:*** :**.***:*   ****:***:***

4534|gene|nph       FGSTGVRALVAVVSLFWLFPYVMLQQIGAGGALAALTDGVVPFWAGASLITGFMILYVVL
201|gene|hut        FDSRALRGLVAGISLFWLLEYVMLQQVGAGRALESLTEGAIPYWAGATLITAFMIGYVVL
1785|gene|nrc1      FGSRGLRGLVAGVSIFWLFPYVMLQQIGAGEALVGLTGGAVPYWAGAGFITLFMVVYVAI
2133|gene|hla       FGSVGLRALVAGVSLLWLFPYVMLQQMGAGEALVGLTDGVVPYWGGAALVTAFMILYVVL
11726|gene|hma      FGSTALRVVVAAVSLVWLFPYVMLQQKGAGQAIVGLTNGAVPFWVGAGGITLFMILYVAL
2258|gene|hhi       FGSTALRVVVAAVSLVWLFPYVMLQQKGAGQAIVGLTNGAVPFWVGAGGITLFMIAYVAL
3326|gene|hwa       FASARLRYLVAGVSLFWLFPYIMLQQMGAGEALVGLTSGAVPYWAGAALITVFMIIYVAA
2324|gene|hvo       FGSTRLRAVVAGISLFWLFPYVMLQQMGAGEAIVGLTNGMVPYWAGAAGITVFMIAYVVI
7370|gene|hbo       FGSRALRAMVATISLFWLFPYVMLQQMGAGEAIVGLTGGTVPYWAGAALITVFMILYVVL
                    * *  :* :** :*:.**: *:**** *** *: .** * :*:* **  :* **: **. 

4534|gene|nph       AGMRGIAWTDTLQGAFMLCMVWAALVWVLVAVDGGVSTINAGLTESSP-EFFALGSDFYT
201|gene|hut        AGMRGVAWTDTLQGVFMLVLVWVALAWIAVSA-GGPGELTAAMGEVNP-EFLSLGGGLYS
1785|gene|nrc1      SGMRGVAWTDTLQGVFMLGITWVAFVWVAAEI-AG---TTGGLAGALPAEFRALGGGAYS
2133|gene|hla       AGMRGVAWTDTVQGLFMLSVVWIAAVWVVSAV-GGVGAATGAMLDARP-EFGSFGGGLYS
11726|gene|hma      SGMRGVAWTDTLQGLFMLSLIWVAVAWVLSAV-GGAGEATALLASEEP-AFVGLGGGLYT
2258|gene|hhi       SGMRGVAWTDTLQGLFMLSLIWVAVAWVLSAV-GGAGEATALLASEKP-AFVGLGGGLYT
3326|gene|hwa       SGLRGVAWTDTLQGIFMLGIIWIAVAWVLSSA-GGMDSVSTALATSNP-EFLSLGGGLYS
2324|gene|hvo       AGLRGVAWTDTLQGLFMLGVVWLAVGWVAAAA-GGPTALSNALAINKP-EFLALGGGLYS
7370|gene|hbo       AGLRGVAWTDTIQGLFMLSIVWVAVAWVVSSA-GGLSAISASMAETKP-EFLALGGGLYS
                    :*:**:*****:** *** : * *  *:     .*    .  :    *  * .:*.. *:

4534|gene|nph       PGTMLTFAISIAFGVAMFPQVNQRFFTAASETVLKRSFALWPLLVLLLFVPAFLLGTWAQ
201|gene|hut        PQYMLSMAIAIGFGVAMFPQINQRFFVARSERVLKRSLALWPLLVILLFVPAFILGAWAT
1785|gene|nrc1      PQWMLSQAIGIAVGVSMFPQVNQRFFVADSKRTLKRTFAIWPLLVVLLFVPAFLMGAWAN
2133|gene|hla       PGFIISTAITIAFGVTMFPQINQRFFVAKSGETLKRSFVLWPVLVLLLFLPAFMLGAWAA
11726|gene|hma      PQYIISTAVSIAFGVTMFPQINQRFFAAGSKKVLKRTFALWPVLVLLLFVPAFMLGAWAA
2258|gene|hhi       PQYIISTAVSIAFGVTMFPQINQRFFAAGSKKVLKRTFALWPVLVLLLFVPAFMLGAWAA
3326|gene|hwa       PQWMISTAVTIAFGVTMFPQINQRFFVAKSATVLKRSFTLWPILVLLLFVPAFLLGSWAA
2324|gene|hvo       PQYIIASAVTIAFGVAMFPQINQRFFVAKSGAVLKRSFALWPVLVVLLFVPAFILGTWAA
7370|gene|hbo       PEWMISTAVTIAFGVIMFPQINQRFFMAKDDRVLKRSFALWPILVLLLFVPAFLLGSWAA
                    *  ::: *: *..** ****:***** * .  .***::.:**:**:***:***::*:** 

4534|gene|nph       GLGLQADVGAGESILPILLDTYTPAWFAALVIAGAIAAMMSSSDSMLLSGSSYFTRDVYR
201|gene|hut        GLGVT--PNARGNILPPLLNAYTPTWFAALVVAGAMAAMMSSSDSMLLSGSSYLTRDLYR
1785|gene|nrc1      GVGLP--LPDGENIVPILLSEYTPGWFAALVVAGALAAMMSSSDSMLLSGSSYFTRDIYR
2133|gene|hla       GMPVE--VPANANVLPVVLDEYTPAWFAALVIAGAMAAMMSSSDSMLLSGSSYFTRDVYR
11726|gene|hma      GLGVT--VPEGGNVIPALLGEYTPTWFTALVIAGAMAAMMSSSDSMLLSGSSYLTRDLYR
2258|gene|hhi       GLGIT--VPEGGNVIPALLGEYTPTWFTALVIAGAMAAMMSSSDSMLLSGSSYLTRDLYR
3326|gene|hwa       GLGIS--VPSGSNVIPVLLTEYTPAWFAALVVAGAMAAMMSSSDSMLLSGSSYLTRDIYR
2324|gene|hvo       GLGVA--VPEGANVLPVLLNEYTPVWFAALVVAGAMAAMMSSSDSMLLSGSSYFTRDLYR
7370|gene|hbo       GLGVQ--VPEGSNVIPALLNEYTPVWFAALVVAGAMAAMMSSSDSMLLSGSSYLTRDLYR
                    *: :        .::* :*  *** **:***:***:*****************:***:**

4534|gene|nph       PL-----VDDGITERQEDRLGRIGVAVFAIAALAASVWAEAEAFGAVAVGSVLVEIGDLA
201|gene|hut        PF-----VDPDASDRREDLVARLAVVAFALIALAMSLGTNL----------TLIEIGATA
1785|gene|nrc1      PF-----VNADATARREDTLGRVGVAAFAVAAFGGSLLRPG----------SLLEVGSTA
2133|gene|hla       PV-----INADASERREAWIARIGVAVFALLAFVASLFRPG----------TLIEVGDTA
11726|gene|hma      PLTGRGDASDEETDRREALVARVGVVVFATLSFVASLYTPG----------TLVQIGDTA
2258|gene|hhi       PLTGRDDASDEATDRREALVARLGVVAFATLSFIASLYTPG----------TLVQIGDTA
3326|gene|hwa       PL-----INPTASTSREGWIGRFGVAGFALATFAASLFRPG----------TLVEIGDTA
2324|gene|hvo       PF-----VNPDASDAREAWLARIGVALFATLTFVASLFRPG----------TLVSVGDTA
7370|gene|hbo       PF-----VNPTASDEREGWIARIGVAVFATLSFVASLFQPG----------TLINVGDTA
                    *.      .   :  .*  :.*..*. **  ::  *:               *:.:*  *

4534|gene|nph       FGGFAQLTVPVLVALYWRGTTKQGLVAGILLPQAVYLAFNFLPATEVGS-----AMLFSE
201|gene|hut        FKGYAQLTLPVLVALYWRGTTRAGMLAGVGISQAFYLLATFTDPVPAT------------
1785|gene|nrc1      FGGFAQLAPPVALAMYWRRTTKAGMFAGVLGTQAFYLATVFGPPVTLAG-----VPIIAS
2133|gene|hla       FSGFALLALPVICALYWDRTTRSGMIVGVLVPQIVYLAVVLSAVVAAVP------TLPRA
11726|gene|hma      FSGFAQLTVPVALALYWQGTTRSGMYAGVVGSQVFYGLHVFPVLATVGGLFGLDVALPTA
2258|gene|hhi       FSGFAQLTVPVALALYWQGTTRTGMYAGVVGSQVFYGLHVFPVIATVGGLVGLDVALPTA
3326|gene|hwa       FGGFAQLTLPVLIALYWSQTTRQGMFAGIAGSQVFYLLHVFIPSTTIAG-----VTVFGS
2324|gene|hvo       FGGFAQMALPVIVALYWAKTTRTGMFAGILGSQAFYLAHVFVPAVEVGS-----VTLFGA
7370|gene|hbo       FGGFAQMALPVMVALYWPKTTKLGMLAGIGGGQVFYILHVFLPELTVSG-----TTLFGG
                    * *:* :: **  *:**  **. *: .*:   * .*    :                   

4534|gene|nph       TYLGWGISIYCLLLGLVATVVVSAATTKADSERPALFFES----LRRG
201|gene|hut        -YGGWQAGLIGMGIGLVVTVGVSLVTRAAPEENADRFVTPES--TDAD
1785|gene|nrc1      SYFGWFAQVVGLPLGVVLTVGVSAVTAPSDTENASAYVDA----LRAD
2133|gene|hla       VAGGWDVALGLMVLSAVLTVGVSLVTVPTAEADASRFAVAG------D
11726|gene|hma      -YLGWTPGIVGILVGLVLTVTVSLMTAPAATEDRTAYAVSG---VESD
2258|gene|hhi       -YLGWTPGIVGILVGLVLTVAVSLVTAPAATENRTAYAVTG---IESD
3326|gene|hwa       TYLTWDFALYGIVLSLVLTVGVSLITTAGADEQTEAFAVGSRSQSRAD
2324|gene|hvo       TYLTWDYALWGMALSALLTVGVSAMTAAAPEENQSRFTDG----LRAD
7370|gene|hbo       TYFGWDFALWGMLLSFGLTVGVSYLTPAAADEDAGTFAVG----SRAD
                        *   :  : :.   ** **  *          :          .