HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0184COG0124KOG1936arCOG00404Histidyl-tRNA synthetasehistidyl-tRNA synthetase

HOG Organism Gene ID Name Annotation
cHOG0184 nrc1 VNG2005 hisS histidyl-tRNA synthetase
cHOG0184 hmu HMUK1302 Hmuk_1302 histidyl-tRNA synthetase( EC:6.1.1.21 )
cHOG0184 hma RRNAC3183 hisS histidyl-tRNA synthetase
cHOG0184 hwa HQ1107A hisS histidyl-tRNA synthetase
cHOG0184 hla HLAC2219 Hlac_2219 histidyl-tRNA synthetase
cHOG0184 hbo HBOR04550 Hbor_04550 histidyl-tRNA synthetase( EC:6.1.1.21 )
cHOG0184 hut HUTA1986 Huta_1986 histidyl-tRNA synthetase
cHOG0184 hvo HVO_1854 HVO_1854 hisS histidyl-tRNA synthetase
cHOG0184 nph NP5044A hisS histidyl-tRNA synthetase
cHOG0184 hhi 447 hisS histidyl-tRNA synthetase
MUSCLE (3.6) multiple sequence alignment


2005|gene|nrc1      MYDRLKGFRDFYPAEMGPRRAAIDAIEDAAASYGFREVGTPAMERTEMYVDKSGAEIVDE
13183|gene|hma      MYDSVKGFRDFYPKEMQARRWAMDTLEDVAQRYGFREIGTPALEPTEMYVDKSGEEIVEE
447|gene|hhi        MYDSVKGFRDFYPEEMQARRWAMDTLEDVAQRYGFREIGTPALEPTEMYVDKSGEEIVEE
5044|gene|nph       MYDGLKGFREFYPGEMSARREVTDTIETRARRYGFREVGTPALERTQLYVDKSGEEIVEE
2219|gene|hla       MYDGLKGFRDFYPGEQSARREVTDAIEDAASRYGFREIATPALERTEMYVDKSGEEIVEE
1107|gene|hwa       MYDRLKGFRDFYPPEMTARRQVIDILETTATQYGFREVGTPTLEQTQMYVDKSGEGIEEE
1986|gene|hut       MYDGIKGFRDFYPAEMAAHREVIDTVEDTAARYGFREIATPALEETRMYVEKSGEEIVED
4550|gene|hbo       MYDRLKGFRDFYPDEMSARRQVFDAVEDAAARYGFREIATPRLERTQMYVDKSGEEIVEE
                    *** :****:*** *  ..* . * :*  *  *****:.** :* * :**:***  * ::

2005|gene|nrc1      LYSFTDQGGRDVALTPELTPTVARMVVAKQQALSKPIKWYSSRPFWRYEEPQQGRFREFY
13183|gene|hma      LYSFEDKGGRKVALTPELTPTVARMFVAKQQELSKPIKWVSTRPFWRYEEPQQGRFREFY
447|gene|hhi        LYSFEDKGGREVALTPELTPTVARMFVAKQQELSKPIKWVSTRPFWRYEEPQQGRFREFY
5044|gene|nph       LYAFEDKGGREVSLTPELTPTVARMVVAKQQALAKPVKWFSTRPFWRYEQVQQGRFREFY
2219|gene|hla       LYAFEDKGGRGVSMTPELTPTVARMVVAKGQELSKPIKWMSTRPFWRYEQVQQGRFREFY
1107|gene|hwa       LYAFSDDGGRDVTLIPELTPTVARMVVDKQQALSKPIKWVSTRPFWRYEQVQQGRFREFY
1986|gene|hut       LYSFEDQGGRDVALTPELTPTVARMVVEKQQALSKPIKWYSTRPFWRYEEPQQGRFREFY
4550|gene|hbo       LYAFEDKGGREVSLTPELTPTVARMVVAKQQALSKPIKWVSSRPFWRFEQVQQGRFREFY
                    **:* *.*** *:: **********.* * * *:**:** *:*****:*: *********

2005|gene|nrc1      QTNLDIFGTSDPRADAEVLAVAADGLTSLGLTGADFEFRVSHRDILGGLLAAF---DATV
13183|gene|hma      QTNVDIFGSAEPTADAEILAVAVDMLTDLGLTGEDFEIRVSHRDILSGVLESF---EADV
447|gene|hhi        QTNVDIFGSAEPTADAEILAVAVDMLTDLGLTAEDFEIRVSHRDILAGVLESF---GADV
5044|gene|nph       QTNIDIFGSERPEADAEVLATAADALTDLGLDGADFEFRVSHRDILGGLLAAM---DSDV
2219|gene|hla       QTNIDVFGSSAPEADAEVLAVAADALTDLGLTNDDFEFRVSHRDILGGLVRALAADPDAV
1107|gene|hwa       QTNVDIFGTADPIADAEILAFAADALRNLGLTASDFEFRVSHRDILSGLLASITNDDADI
1986|gene|hut       QTNVDIFGSEEPEADAEILAFAADALTNLGLDADDFDFRVSHRDILGGLLEAF---DADV
4550|gene|hbo       QTNVDIFGSSEPEADAEILAFAADALTSLGLTADDFEFRVSHRDILGGLLDSF---DADV
                    ***:*:**:  * ****:** *.* * .***   **::********.*:: ::      :

2005|gene|nrc1      DTEAAIRTVDKREKIERAAYLDDLAAAGLSYDQAEQFDDLL----DGDDLDALVSFAGTD
13183|gene|hma      DVPEAIRAVDKRAKVDHDEYLDALAEAGLSYGQADTFDEMLQ--IDAEEIETLGDLTGSE
447|gene|hhi        DVPEAIRAVDKRAKVDHDDYLDALVEAGLNYGQADKFDEMLQ--IDAEEIETLADLTGSE
5044|gene|nph       DTTDAIRAVDKREKIDDEEYRSLLVGAGLTHEEADTFDSLL----RTDDLSELVEFAGTD
2219|gene|hla       DTKAAIRAVDKRAKVDDGEYLGLLSDAGLDRATAQEFDDLISDVETVDDLDAVAEAGGED
1107|gene|hwa       DTRAAIRAVDKRAKIEQAEYHGLLTDAGLSYDQAQSFDDLL----TTADLDEIATV-GND
1986|gene|hut       DQRAAIRAVDKSAKIEEAEYYDLLTESGLSYDQAEQFDALL----ATDDLDELTDFAGTD
4550|gene|hbo       DTRNAIRAVDKRAKVEDEEYLGLLSDAGLSYDQAREFDNLI----VAGDLDAIAEFGGDD
                    *   ***:***  *::   * . *  :**    *  ** ::       ::. :    * :

2005|gene|nrc1      RVRDAVANLRNVLDAAETLGVRQYCDVSLTTARGLDYYTGVVFECFDSTGDVGRAVFGGG
13183|gene|hma      DVRTATDNLQAVLDAAEDFGVREHLTVSLTTARGLDYYTGVVFECFDSTGEVSRSVFGGG
447|gene|hhi        DVRAATDNLQAVLDAAEDFGVREHLTVSLTTARGLDYYTGVVFECFDSTGEVSRSVFGGG
5044|gene|nph       RVEAAVENLQAVLDAAADFGVREFCSVSLETARGLDYYTGVVFECFDTSGEVSRSVFGGG
2219|gene|hla       -VEAAVENLRNVLAAADDFGAGAFCEVSLTTARGLDYYTGVVFECFDSTGEVSRSVFGGG
1107|gene|hwa       IVTTAVQNLRSVLAAVDDLGVGEFCDISLTTARGLDYYTGVVFECFDATGEVSRSVFGGG
1986|gene|hut       RVADAVENLEAVLAAAEDFGVREYTTISLETARGLDYYTGVVFECFDSVGEVSRAVFGGG
4550|gene|hbo       -VKDAVENLRAVLAATEDFGVRQYCDISLTTARGLDYYTGVVFECFDSTGDVSRAAFGGG
                     *  *. **  ** *.  :*.  .  :** *****************: *:*.*:.****

2005|gene|nrc1      RYDDLIERFGGQPTPAVGVAPG--HATLNLLLENAGVLPDDEFTPDYYVLQVGDTDAEAA
13183|gene|hma      RYDDLIEGFGGQPTPAVGFAPG--HATLQLLCQRAGVWPAEELSTDYYVLQVGDTRPTAA
447|gene|hhi        RYDDLIEGFGGQPTPAVGFAPG--HATLQLLCQRAGVWPAEELSTDYYVLQVGDTRPTAA
5044|gene|nph       RYDDLIESFGGQPTPAVGVGIG--HETLSLLCQRAGVWPAEELSTDYYVLTVGDTRDVAL
2219|gene|hla       RYDDLIESFGGQPTPAVGVAPG--HAPLSLLCQRAGVWPDEELTTDYYVLSVGDTRSEAT
1107|gene|hwa       RYDNLIESFGGQPTPAVGVAPG--LAPLSLLCQRAGVWPTEELTTDYYILTVGDTRSVAT
1986|gene|hut       RYDDLIESFGGQPTPAVGVAPGVMNSTLPLLLQRAGVWPEEELSTDYYVLQVGDTRSVAS
4550|gene|hbo       RYDNLIEDFGGQPTPAVGVALG--DATLQLLCERADVWPEEELQTDYYVLTVGDTRAVAS
                    ***:*** **********.. *    .* ** :.*.* * :*: .***:* ****   * 

2005|gene|nrc1      DVASALRERGN--RVDTDITGRSFGAQMNYADNVGADTVVIVGEQDLADGNVTIKNMASG
13183|gene|hma      RIARDLRERGH--VVESDVADRSFGAQMGYADGINAETVVIVGEQDLENDEVTLKEMDDG
447|gene|hhi        RIARDLRERGH--VVESDVADRSFGAQMGYADGINAETVVIVGEQDLENDEVTLKEMDDG
5044|gene|nph       DVARELRALGH--VVETDLSDRGFGDQLSYADGINAETVVVVGEQDLEDDAVTLKDMASG
2219|gene|hla       ALARDLRALGDDVVVEQDVSGRSFGAQLGYADSINAETVVVVGERDLENGEYTVKDMASG
1107|gene|hwa       RIARELRVNKN--TVEIDIADRSFGAQMGYADSINAETVIIVGERDLENDEITIKDMNSG
1986|gene|hut       RIARELRERGH--VVETDVSDRSFGGQLDYADSINAETAIIVGERDLENDEITIKDMASG
4550|gene|hbo       RVARDLRDRGN--VVEMDVADRSFGAQMGYADSINAETVVIVGEQDLENDEVTVKDMDTG
                     :*  **       *: *::.*.** *:.***.:.*:*.::***.** :.  *:*:*  *

2005|gene|nrc1      EQTTAPIAAFP--GAHDAPRVEDFA-
13183|gene|hma      EQVSVPLSAFP--GDYDRPTFEDFAE
447|gene|hhi        EQISVPLSAFP--GDHDRPTFEDFAE
5044|gene|nph       DQTQVPLAAFP--PEEGRPTYDDYA-
2219|gene|hla       DETTVPVEEFPPEGGEELPTYEDYE-
1107|gene|hwa       DQTTVPVEAFP--GDHDAPTYEDVV-
1986|gene|hut       DQVQVPVADFP--GDHDRPTYDDLA-
4550|gene|hbo       DQTTAPVSDFP--GDRDRPTYDDFA-
                    ::  .*:  **       *  :*