HOG Organism Gene ID Name Annotation
aHOG1831 hmu HMUK1479 Hmuk_1479 conserved hypothetical protein
aHOG1831 hut HUTA2131 Huta_2131 Laminin G sub domain 2
aHOG1831 hwa HQ2945 stt3 transmembrane oligosaccharyl transferase
aHOG1831 nrc1 VNG0005 vng5 no entry
aHOG1831 hma Hma_13242 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


2131|gene|hut      METGRDEVESFLEANPELEAELEALLTIDARGP-WEFDDIPLDSGAFGECVSRGIAVEHD
13242|hp|hma       MSDTPGA-GAVLDDRPELRDATEVVLAVDDEQDGWTFDDIPIDSGQFGELVSAGIVEKDG
2945|gene|hwa      MSDIRDEVDAIIDDRPETHRVFTEILQIDTEYSVWTFEDIEADTGLFGELVSRGIVEKQD
5|hp|nrc1          MSDVRAATTALLADRPALADALDTLVEVDRSQDTWTFDDAPVDSGVFGELVGRGIVVESG
                   *.       :.:  .*        :: :*     * *:*   *:* *** *. **. : .

2131|gene|hut      DGGYRLANPDAVRAALDHD---------------------VDSAAESEQSSRIPDVN---
13242|hp|hma       DE-YRVADPDAVRAALNGD---------------------SEVSNDSGQGLALGDAL---
2945|gene|hwa      DG-YSLADPTAVDAALAHRDNVNHAENTELATDGSRSDVSETVSDDDHSRRQLSDQIDMS
5|hp|nrc1          DG-YVLADRQAVRAALGDPD--------------------ADPSDADGAAVSLRDRV---
                   *  * :*:  ** ***                           :  .     : *     

2131|gene|hut      -----VTLDVPRETVLALLGALSLLVAFRVVFVYQGVFRE-VITLLGNDPYKRLYWVEQL
13242|hp|hma       ------RFDFDTRATGLLVAALAVVFVAR-TYVIGSIYRGGDIVLSGNDPYYYRYHVEQV
2945|gene|hwa      VDRVMETISNNRDRILSVIGVLALVVAFR-LVAVRSVFQEGYVLLLGNDPYFYRYWVFDF
5|hp|nrc1          -----PSLSVSSRAAWFLAASLLVVVALR-VFVFPRVFRAGHVVLLGNDPYYYRYLVSAM
                          :.        : . * ::.. *   .   ::.   : * *****   * *  .

2131|gene|hut      QAF--PAFDPGALGSIPEGVRLTGDTMMLVTLWWVSELFGGTPAAARVTLAIYPVVAAVV
13242|hp|hma       AANAGSAADFGALSVLPGGLA-NGEPLTIATLWWVASLFGGSNPVIGHVLAWYPVVSALV
2945|gene|hwa      VTANRSPLT------VANGIE-QGEPLLVATLQIVTALFGGGPAAAEQVLAWYPVAAAVV
5|hp|nrc1          QQSGAGLLD------VPARIT-RGEPLLVVVLVGATRLLGGSASAAAHVTAWYPVVAAVV
                                  :.  :   *:.: :..*  .: *:**  ..   . * ***.:*:*

2131|gene|hut      TGLFVYATTKLLTDDIRIALASVLMLAVTPINGYRMALGFGDHHAFDYVWIALTVLLVVW
13242|hp|hma       TSVLLYLLAVRVSGDRRVGLASVLFLAFIPGHAFRTSLGFADHHAFDYPWLGLTALALVV
2945|gene|hwa      CGVSVYLIGTRLSDDRRVGLASTAILATLPVHAYRTSIGFADHHAFDVAILAIVFVTVAA
5|hp|nrc1          TAVACYLLATTLSHDRRVGITAVLVLAVLPVHAYRTALGFGDHHALDLVWLSLTVLAAVR
                    .:  *     :: * *:.:::. .**  * :.:* ::**.****:*   :.:. :  . 

2131|gene|hut      WERSADGMATGPIRNRLRSRRLWVAIAALGGTLAVQTMSWVGSPMVLVPFGLLMFVRGAV
13242|hp|hma       ALTTATNRTS------LRQPQPWIAAVGIGVGIAGQVLAWEAGPLLVLPASLVVLGQTLL
2945|gene|hwa      YERTSPTSIS-----QLLELTPWIILAGVG--IGAHTLAWNAGALLLTPLGVYGVIRALA
5|hp|nrc1          LLPGAGVAVSDD--SGWRRHLPWGCVLA-G-SVAAQAHSWNAAPLLFVPLVVYAVARS-A
                       :    :            *    . *  :. :. :* ...::. *  :  . .   

2131|gene|hut      AFRQSRSPAVAALPYLGGIGVASTIVGTMHLAFGWLPVSRVIVPLAVFVLGAGAVGYF-E
13242|hp|hma       DVSNDRSALVRNAPVLAGVSLGALLAGGVHTITGW-QTALVASAPALLTLGTVAVIATAE
2945|gene|hwa      SVRHDVSVLYRLTPLTASMAIGGGIGVLGHEALGW-QSTTMIIPPTLLAIALFTLAIVAE
5|hp|nrc1          ALADGESPLADL-PLAAALTAGGVLAVAGHVLLGW-QSPVIVAPPLLAGLGVGAAALIAA
                    .  . *      *  ..:  .. :    *   **   . :  .  :  :.  :      

2131|gene|hut      ACRSLSLSATVTVASSVVFSVVGTVGFALVGPGMDAVV----ERAVGLFRGKQIAESAGL
13242|hp|hma       AARRFGGTAGQLAVVDIGLGVISLLVFRF---GFTEQWGTFDRRLDTLFRSDAIAETYGL
2945|gene|hwa      GCGRVGLDYRITAIGVVLSGAAVLLGSIELIPRFGDEFRSQTDRLISGPGTENIFEAQSL
5|hp|nrc1          GVRRVGVPSWTAPVLTTASGVAAFAVVATIDPSFVAELQQEGARFVGQSGS-SIVETKSL
                   .   ..             ..            :         *         * *: .*

2131|gene|hut      FSAE-SGLVVQPILFFGFVLFLALPFIVLGAWHVFENNDPRWTAPVVYAVYFLFWAGVKV
13242|hp|hma       FSADAFGF----LFLLGLTLFVALPAMVWGI-NLARSDQSGWLVVSSYAWVLLVLAVIQV
2945|gene|hwa      FSAD-FGFILAPVIFFGLAIFVSIIVFVWASWTGWTRDRGDLLLICAYGGTLFILSLLQV
5|hp|nrc1          FSTT-YGLFAGPIFFYGTALLFALPAGAWAVYTGVARSRPRWLLTGCYGTVLFAFAVTQV
                   **:   *:    ::: * .::.::   . .       .         *.  ::  :  :*

2131|gene|hut      RFGGPLTIFTAIFGGIGFVKAAA-WVDLARP---VTSFTEKT------------------
13242|hp|hma       RFVGELATFLALFAGLAFVWAAS-WVDLARP---VLTTGDRDFRD---------------
2945|gene|hwa      RFAGHLALPVAILTGISFVWLVAKVTDISPPTVRPVGVGTQSTSEQRVAWRRHTTSTDTD
5|hp|nrc1          RFSGELSVFVAVFAAVAFVYFLS-VVDLADP---PLDFSARSSDRERVR-----------
                   ** * *:   *:: .:.**   :  .*:: *         .                   

2131|gene|hut      ----PIARFERPEGGQLV----------SLFLLFLLVGSLGMVQLPIKQSQLVVSEDTYE
13242|hp|hma       ----VLVPDTRAVAS--------------LFVLFLLFGSLGMVQVPVKTSQVLVDDGTYD
2945|gene|hwa      TNAGTTDSSTRERSSGSGDGTSRRQMFTAVIVLFLLVGGLGAVMTPVRTATLTFGDDTAS
5|hp|nrc1          ----SLAIPTRSRALRIG-------------VAFLLVGGLGAVMTPLRTNTLVQSDDAYH
                             *  .                 : ***.*.** *  *:.   :  .:.:  

2131|gene|hut      TAQWIDGYSDERNLEYPENGVFTGWSSTRIYNYFVNGHADSYWFEQQYFESFLGSTTPDA
13242|hp|hma       AATAIEADAAERGLEYSENYVLSRWGQNRVYNYFVNGESRSYSYARQTYGPFIAATDPDE
2945|gene|hwa      AIDEMDAFATAENRSWPETYVLSRWGDNRAYNSHLNGNSQSYGYARSNYLDFLRSDESEE
5|hp|nrc1          AATHVEAALNAPDWTDDTTYVFSRWSRNRLYNWFGSGNSRSYWYARSNYDDFLRSTTPGK
                   :   ::.     .     . *:: *. .* ** . .* : ** : .. :  *: :  .  

2131|gene|hut      WYERLRDRYGFVVYS-----RPMNGSSGPTVERQLETGDSTPGFAQYRLVHTS--GPKRV
13242|hp|hma       AHNRISNRVGYVVTTEADI-EGPTTMYTRLHQRFGSRGDDVGGLAHYQPIFTSEDGSHKA
2945|gene|hwa      ------------------------------------------------------------
5|hp|nrc1          WNDRLQDRAAFVVFDTNSVPDGATGTIGSALTAWGS------GLAHYRAVWAG--DAKTV
                                                                               

2131|gene|hut      FQLVEGATIVGIDRTSDTVTAETSPTVSGKSHTYERNAAPNPYGTYAVTVPYPGSYSIAG
13242|hp|hma       FAVVPGGTVKGSVAPNATVSVETTVAVSDREIAYERQTTADRNGAFTVTVANPGTYTVTT
2945|gene|hwa      ------------------------------------------------------------
5|hp|nrc1          YRVVPGATVTGTAASNASVTLTHEGTVSGQAVTYTRTTTAAANGTYTVTVAYPGAYSVST
                                                                               

2131|gene|hut      D-----QVDVAASAVENGTRVVRHARDGLAHWPFDATDGTVAYDRVGGIQGDISNATVAE
13242|hp|hma       DSGSETTVEVTEQTVYGGGNVTVE------------------------------------
2945|gene|hwa      ------------------------------------------------------------
5|hp|nrc1          GG----TVTVPAAAVGNGTTVSA-------------------------------------
                                                                               

2131|gene|hut      NGVNGTALEFTRENDSQVRAAVESPPEFTVSMWLKPQALDTTEANDYRILARSGRGLVLN
13242|hp|hma       ------------------------------------------------------------
2945|gene|hwa      ------------------------------------------------------------
5|hp|nrc1          ------------------------------------------------------------
                                                                               

2131|gene|hut      VEESGRLTFRLPGTDAKALGGGSVPVGNWTHVAATYDGSQRTLYVDGAAVATDTVDVGPP
13242|hp|hma       ------------------------------------------------------------
2945|gene|hwa      ------------------------------------------------------------
5|hp|nrc1          ------------------------------------------------------------
                                                                               

2131|gene|hut      SWGGQLTFGGGGDPTHTFDGTIDEIRLYERALNDTELSAQAVQSRNDQ
13242|hp|hma       ------------------------------------------------
2945|gene|hwa      ------------------------------------------------
5|hp|nrc1          ------------------------------------------------