HOG Organism Gene ID Name Annotation
aHOG1830 hmu HMUK1283 Hmuk_1283 rhodopsin
aHOG1830 hut HUTA0315 Huta_0315 rhodopsin
aHOG1830 hwa HQ1014 bopI bacteriorhodopsin precursor (Squarebop I)
aHOG1830 hwa HQ1017 bopII bacteriorhodopsin precursor (Squarebop II)
aHOG1830 nrc1 VNG1467 bop bacteriorhodopsin
aHOG1830 hma Hma_12030 xop1 bacteriorhodopsin precursor
aHOG1830 hma Hma_13161 bop bacteriorhodopsin
MUSCLE (3.6) multiple sequence alignment


1017|gene|hwa       -------MATPGSEA------------TWLWIGTIGMVLGTVYFAVRGRGSTDPEQQTYY
315|gene|hut        ---------MTDLTT------------ISLWAGTAGMFLGMLYFIATGWNVRDSRRKKFY
13161|gene|hma      -------MPAPGSEG------------IWLWLGTAGMFLGMLYFIARGWGETDGRRQKFY
1467|gene|nrc1      ----MLELLPTAVEGVSQAQITGRPEWIWLALGTALMGLGTLYFLVKGMGVSDPDAKKFY
1014|gene|hwa       MSQLALQMSSLGVEG----------EGIWLALGTIGMLLGMLYFIADGLDVQDPRQKEFY
12030|gene|hma      --MLPLQVSSLGVEG----------EGIWLALGTVGMLLGMVYFMAKGWDVQDPEQEEFY
                                                 *  **  * ** :** . * .  *   : :*

1017|gene|hwa       IITTLIPAIAAAAYLAMATGLGVISM---------PIRGTEVIDIYWARYADWLLTTPLL
315|gene|hut        VVTTFIAAIAFVNYLAMATGFGKLPIEVIENILGTEFGSGVPEEIYWPRYTDWILTTPLL
13161|gene|hma      IATILITAIAFVNYLAMALGFGLTFI---------EF-GGEQHPIYWARYTDWLFTTPLL
1467|gene|nrc1      AITTLVPAIAFTMYLSMLLGYGLTMV---------PF-GGEQNPIYWARYADWLFTTPLL
1014|gene|hwa       VITILIPAIAAASYLSMFFGFGLTEV---------SLANGRVVDVYWARYADWLFTTPLL
12030|gene|hma      VITILIAGIAASSYLSMFFGFGLTEV---------ELVNGRVIDVYWARYADWLFTTPLL
                      * ::..**   **:*  * *   :          : .     :**.**:**::*****

1017|gene|hwa       IIDLALVAGARKQTLYKLIIIDAIMILGGLAGSMM------QQGAVIRIVWWAVSTAAFI
315|gene|hut        LYDIALLAGADRNTISTLVGLDVLMILTGVVATLTFTGGAGLEVEGARILWWGVSTGFLL
13161|gene|hma      LYDLGLLAGADRNTIYSLVSLDVLMIGTGVVATLS-AGSGVLSAGAERLVWWGISTAFLL
1467|gene|nrc1      LLDLALLVDADQGTILALVGADGIMIGTGLVGALT-------KVYSYRFVWWAISTAAML
1014|gene|hwa       LLDIGLLAGASQRDIGALVGIDAFMIVTGLVATLT-------KVVVARYAFWTISTISMV
12030|gene|hma      LLDIGLLAGASNRDMASLITIDAFMIVTGLAATLM-------KVPVARYAFWTISTIAML
                    : *:.*:..* .  :  *:  * :**  *:..::        .    *  :* :**  ::

1017|gene|hwa       ILLYYLLGELSERARSRSAETGIVFNRLRNITLGLWALYPIVWILGTGGGFGIIAVTTEI
315|gene|hut        VLLYFLFSTLTAKANELSADTQRTFKLLRNMIAVLWLVYPVWWIIGT-EGLGAIGIGPET
13161|gene|hma      VLLYFLFSSLSGRVANLPSDTRSTFKTLRNLVTVVWLVYPVWWLVGS-EGLGLVGIGIET
1467|gene|nrc1      YILYVLFFGFTSKAESMRPEVASTFKVLRNVTVVLWSAYPVVWLIGS-EGAGIVPLNIET
1014|gene|hwa       FLLYYLVAVFGEAVSDADEDTRSTFNALRNIILVTWAIYPVAWLVGT-EGLALTGLYGET
12030|gene|hma      FVLYYLVVVVGEAASDASEEAQSTFNVLRNIILVAWAIYPVAWLVGT-EGLGLVGLFGET
                     :** *.  .   . .   :.  .*: ***:    *  **: *::*:  * .   :  * 

1017|gene|hwa       MLYVMLDIGTKIGFGAVLLESQDVLQAASHPSSTNDIKSH----
315|gene|hut        AGFAVLDVTAKVIFGIILLRSHDVLDEGAPSAS-----------
13161|gene|hma      AGFMVIDLVAKVGFGIILLRSHGVLDGAAETTGTGATPAD---D
1467|gene|nrc1      LLFMVLDVSAKVGFGLILLRSRAIFGEAEAPEPSAGDGAAATSD
1014|gene|hwa       LLFMVLDLVAKVGFGFILLRSRAIMGGGSEPTPSAQETAA---D
12030|gene|hma      LLFMILDLTAKIGFGFILLRSRAIVGGDSAPTPSAE--AA---D
                      : ::*: :*: ** :** *. :.     .