HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0182COG0500KOG4300 KOG1269 KOG1331 KOG1499 KOG1541 KOG1975 KOG2793 KOG3010 KOG3045arCOG02956SAM-dependent methyltransferaseshypothetical protein

HOG Organism Gene ID Name Annotation
cHOG0182 nrc1 VNG0184 vng184 no entry
cHOG0182 hmu HMUK0182 Hmuk_0182 Methyltransferase type 11
cHOG0182 hma RRNAC2014 methyltransferase
cHOG0182 hwa HQ1416A S-adenosylmethionine-dependent methyltransferase
cHOG0182 hla HLAC0529 Hlac_529 Methyltransferase type 11
cHOG0182 hbo HBOR26310 Hbor_26310 methylase involved in ubiquinone/menaquinone biosynthesis
cHOG0182 hut HUTA2403 Huta_2403 Methyltransferase type 11
cHOG0182 hvo HVO_0574 HVO_0574 methyltransferase
cHOG0182 nph NP5122A homolog 11 to S-adenosylmethionine-dependent methyltransferase 3
cHOG0182 hhi 2519 HAH_2519 methyltransferase
MUSCLE (3.6) multiple sequence alignment


184|hp|nrc1         ---------------MWRD-RDALADLRLSDRSRILDVGAGTGEFARVLAAESSAP--VV
2403|gene|hut       MRRFDAEYLTHTRRGMWADSREALSTLDLSTRERVLDVGSGTGALTRVLREETPGD--VV
5122|gene|nph       MREFSAEYLRTTRRGMWADSRAALSPLDLGGCERILDVGCGEGALTRVLDEESPGT--VV
12014|gene|hma      ---------------MWTDSREALSDLQLGECERVLDVGCGTGELTRVLREETDGT--VV
2519|gene|hhi       ---------------MWADSREALSDLQLGECERVLDVGCGTGELTRVLREETDGT--VV
529|gene|hla        MRRFSAEYLEHTRRGMWTDGRQALADLDLAGRRRILDVGCGTGELTRVIDAETPSDTTVI
1416|gene|hwa       MREFSSEYLTHTRRELWADSRAALTPLSLEDRTRILDVGTGTGEFAQVLDTESPGD--IV
26310|gene|hbo      MRKFSPEYLRRTREGMWDDSRDALQDLSLPDRSRVLDVGCGTGELSRVLDAETPGE--VV
                                   :* * * **  * *    *:**** * * ::.*:  *: .   ::

184|hp|nrc1         ALDADTTLLGHT-ADGAAHRVAGDATRLPVRDDACDLVACQALLINLPEPAAAVEEFARV
2403|gene|hut       GVDADPQLL----DHVEGPAVVGDAFGLPFPDDTFDLVVCQALLINLPEPVDAVREFARV
5122|gene|nph       GCDRDPGLL----VELSGPAVQGDAYQLPFADGSFDLVVCQALLVNLPEPERAIDEFARV
12014|gene|hma      GLDADTDLL----AAAGDPTVCGDATQLPFDDDSFDLVVCQALLINLPDPEVAVREFARV
2519|gene|hhi       GLDADTDLL----AAAGDPTVCGDATRLPFAGDSFDLVVCQALLINLPDPEVAVREFARV
529|gene|hla        GVDADPKLLRVAREETGLPYVAGDAIRLPLPDGAVDLAVCQALLINLPDPAAAVREFARV
1416|gene|hwa       CLDMDPELLTIARSKTDLTTIIADATQLPIKSDAVDLVTCQALLSNLPDPVNILQTFARV
26310|gene|hbo      CLDADPELLRVAREAADLPTVVGDATRLPFPDDTFDLVVCQALLVNLPRPTDAIESFTRA
                      * *. **           : .**  **. ..: **..***** *** *   :  *:*.

184|hp|nrc1         SSELVAVIEPDNSAVTVASTVAAESALSARAREFYVDGVHTDVTLGADAADVLADAGLRD
2403|gene|hut       SRDGVAVIEPDNESVTVESTVDGESALAGEAREHYLAGVDTDVTLGSDVASVLAEAGLAS
5122|gene|nph       AADRVACIEPDNSAVAVESTVDAESALAARARQRYLAGVDTDVALGADAADLFREAGLSN
12014|gene|hma      ATDRVAAIEPNNAAVTVESTVDAEPMLARRARRLFLDGVRTDVTLGSDAADVFSDAELTV
2519|gene|hhi       ATDRVAAIEPNNAAVTVESTVDAEPTLARRARRLFLDGVRTDVTLGSDAADVFRDAGLSV
529|gene|hla        SSELVAAIEPDNADVTVTSTVDAEERLEREAREAYLHGVDTDVALGDRVREAFTATGLTD
1416|gene|hwa       SSELVAAVEPDNAAVSVASTVDTEAQIERRAREAYIAGIQTDVALGDRLSTAFDNAGLDD
26310|gene|hbo      SSDLVAAVEPDNAAVGVDSTVSAEVALERSVRESYMAGVQTDVALGDRLPDIFESVGLCD
                    : : ** :**:*  * * ***  *  :   .*  :: *: ***:**      :  . *  

184|hp|nrc1         VSTTRHEHVRVTEPPYDDGDLDAAARKATADRLADQRPELAAGGLADSAYDELRAAWREM
2403|gene|hut       VEITRYDHARTIAPPYGEADVESARRKASGSGIATDRETLLDGGLSTEAYDRLRQRWRQM
5122|gene|nph       VRTRRYDQTLVVEPPYSEAAVRAAGRKASGEGLRKRRETMAG---TEEALDALRSDWREM
12014|gene|hma      VSTTQYDQEQQIEPPYDDAAMQAARRKATGTGLAHDRETILNGEATPAEYDALRERWRSM
2519|gene|hhi       VSTTQYDQEQRIEPPYDDAAMQAAQRKATGTGLAHNRETILNGDATPAEYDALRERWRSM
529|gene|hla        IRTRRYVHEKRIAAPYAEPALTAAARKASGAGLADHREELIA-ATSETAYDDLRRRWREM
1416|gene|hwa       IVRRRHYHRRTTEPPYDDTALTAAARKAHATALRDHRTELRR-ELSDDAYDTLRHDWREM
26310|gene|hbo      VRTRRYFHRKLIEPPYDDAALEDAARKANGTGLAAHETELRR-TLSDDEYDALRRDWREM
                    :   .: :     .** :  :  * *** .  :      :     :    * **  **.*

184|hp|nrc1         GRDVVAQMQAGEYVRRETVPFYVTVGRLPDDDTA
2403|gene|hut       GRDVIEQMADRTYERTETVPFYVAVGQI------
5122|gene|nph       GREAVQQIQAGKYRRKETVPFYVTVGEVSA----
12014|gene|hma      GRDVVEQMQDEAYERHETVPFFVTVGEIP-----
2519|gene|hhi       GRDVIEQMQAEAYERRETVPFFVTVGEVQ-----
529|gene|hla        GRAVIDEMESGTYERVERVPFDVTVGRTD-----
1416|gene|hwa       GRAVVDQIHSETYRRVEIIPFDVVVGRVSSDQA-
26310|gene|hbo      GRTVVEQMQDERYRRAEVVPFDVVVGRVPE----
                    ** .: ::    * * * :** *.**