HOG Organism Gene ID Name Annotation
aHOG1804 hbo HBOR37960 Hbor_37960 hypothetical protein
aHOG1804 hwa HQ4016 hypothetical protein
aHOG1804 nrc1 VNG5166 vng5166 no entry
aHOG1804 hma Hma_4021 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


4016|hp|hwa       --------------MSDSSPTDEVDVEHPRPAGHFQ--RFNQNEWHYVCDELAQTISLGP
5166|hp|nrc1      ------------------MTADDVGPENPRSEGHYP--RFADNEWHYISDELAQTISLGP
4021|hp|hma       ------------------MTDDDIDPEDPRPTGHYP--RFADNEWHYVSDELAQTISLGP
37960|hp|hbo      MTVEETLKQRFTGLPSDQNAVDASCCKRCREYGSLEEMEFDENERVYA------TVAWKK
                                     . *    :  *  *      * :**. *       *::   

4016|hp|hwa       ATDGKDGDDWILSLTPERENPNDREKMFLRLTPRALHELYVETKDISTDARQAGQSAECG
5166|hp|nrc1      AGDGEDGQDWVLTYTPSERT------------------------------RRTGRKYWCG
4021|hp|hma       AGDGEEGQDWVLTYTPERRDDDDREKVLVRLTPRALHELHIETKDLSVEQRQMGHRAECD
37960|hp|hbo      NLRGEASWELIGLFHQDHGDVAD-----LPEDPRRPCAVLEVTLEPSNALPRFGQIDGAA
                     *: . : :     .                                  . *.   . 

4016|hp|hwa       LCGDQVDLDDAWPDNRNRPCHKNCYADAFGRPPWY----
5166|hp|nrc1      ---------------------------------------
4021|hp|hma       LCGEMVDLDRAIPNARGEPCHKRCWAEYTGAPDWFSDYL
37960|hp|hbo      FTLGQVDV----LDTAGVVARKTVAAD------------