HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0180COG0500KOG4300 KOG1269 KOG1331 KOG1499 KOG1541 KOG1975 KOG2793 KOG3010 KOG3045arCOG0178124-sterol C-methyltransferase

HOG Organism Gene ID Name Annotation
cHOG0180 nrc1 VNG2398 scm 24-sterol C-methyltransferase
cHOG0180 hmu HMUK1127 Hmuk_1127 Methyltransferase type 11
cHOG0180 hma RRNAC2440 scm 24-sterol C-methyltransferase
cHOG0180 hwa HQ3733A S-adenosylmethionine-dependent methyltransferase
cHOG0180 hla HLAC2736 Hlac_2736 Methyltransferase type 11
cHOG0180 hbo HBOR02020 Hbor_02020 methylase involved in ubiquinone/menaquinone biosynthesis
cHOG0180 hut HUTA2258 Huta_2258 Methyltransferase type 11
cHOG0180 hvo HVO_0019 HVO_0019 scm 24-sterol C-methyltransferase
cHOG0180 nph NP0956A homolog 6 to S-adenosylmethionine-dependent methyltransferase 3
cHOG0180 hhi 2873 scm 24-sterol C-methyltransferase
MUSCLE (3.6) multiple sequence alignment


3733|gene|hwa       --------------------------------MSVRQEFDQWANTGRDRGMEERHWHTAK
2398|gene|nrc1      -----------------MPSGGVLPVGVHATPMSVREEFDEWAASGRDKGMEDRHWHTAK
2258|gene|hut       --------------------------------MSVGDAFDQWAEQGKDRGMEQRHWHTAK
2736|gene|hla       --------------------------------MSVREEFDEWAAAGKDRGMEDRHWHTAK
956|gene|nph        --------------------------------MSVRAEFDAWAADGRDRGMEQRHWHTAK
2020|gene|hbo       --------------------------------MSVRDEFDAWAADGRDKGMEDRHWHTAK
12440|gene|hma      MSITRRVRLSVDTCCYEAEIAGILRPQLLKGRMSVREEFDAWAAEGKDRGMEDRHWHTAK
2873|gene|hhi       --------------------------------MSVREEFDAWAAEGKDRGMEDRHWHTAK
                                                    ***   ** **  *.*.***:*******

3733|gene|hwa       YALSRMPIEDGETILDLGTGSGYALRALRETQDIGMSVGLDGSPKMVQNAREYTTDSLLS
2398|gene|nrc1      DVLARMPVEDDDTVLDLGTGSGYAVRALRE-RGVARGYGLDGAPEMAANARTYTDDDDLA
2258|gene|hut       HALGRMPVEDGDVVLDLGCGSGYAARALRAAGGAGRAYGLDRSPQMARNAREYTDDAAVG
2736|gene|hla       HVLARMPVEAGDAVLDLGTGSGYALRALRE-RGIGRAYGLDGAPEMACNARSYTDDDAVG
956|gene|nph        HALARMPVEADETVLDLGCGSGYAARALRDAKDAGRAYGLDGSPEMVRNAREYTDDPQVS
2020|gene|hbo       HVLARMPVEPDDVVLDLGCGSGYAGRALRETKEAGRVYGLDGSPEMARNAQSYTDDEKIG
12440|gene|hma      HVLARMPVEPGDTVLDLGTGSGYALRALRDTNDAGPCYGLDGSPEMLRNAREYTDDDGIG
2873|gene|hhi       HVLARMPVEPGDTVLDLGTGSGYALRALRDTNDAGPCYGLDGSPEMLRNAREYTDDNGIG
                     .*.***:* .:.:**** ***** ****     .   *** :*:*  **. ** *  :.

3733|gene|hwa       FIKGDFHQLPFADGTIDHIWSMEAFYYSQDPLQVLAEIRRVLRSGGTFFCAVNFFDESQH
2398|gene|nrc1      YVVGDFGSLPFADDAIDHVFSFEAFYYASDPRETLAEIRRVLKSGGTFYCGVNYYEENVH
2258|gene|hut       FLVGDFQHLPFGTDSVDHAFSMEAIYYAPDPVEALRELRRVLRSGGTFYCAVDYVADNPH
2736|gene|hla       FLVGDFDALPFADDSLDHVFSMEAFYYAADPHHTLEEIRRVLKPGGTFYCAVNYFAESEQ
956|gene|nph        YVVGDFGSLPFAADSIDHAFSMEAFYYAADPVGALNELRRVLRPGGTFYCAVDYFEESVH
2020|gene|hbo       YLVGDFDELPFADDSIDHVFSMEAFYYAADPHHTLSEVARVLRPGGTFFCAVNYYEENVH
12440|gene|hma      FLRGDFDALPFATDSIDHVFSMEAFYYASDPPHTLEEIARVLRPGGTANIAVNYYEENVH
2873|gene|hhi       FLRGDFDALPFATDSIDHVFSMEAFYYASDPPHTLEEIARVLRPGGTAHIAVNYYEENVH
                    :: ***  ***. .::** :*:**:**: **  .* *: ***..***   .*::  :. :

3733|gene|hwa       THRWQDRISVDMQLWDQTQYREKFRKAGLYIAEQDTIPDEETEIPPADGFPIENWETREA
2398|gene|nrc1      SHDWQDSISVEMTRWDRATYREAFRGAGLHVAAQDLIADTEIDIPAASEFPHEGFDSRAD
2258|gene|hut       TAEWDEYVDVAMTRWSRAEYREAFREAGFHVAEQEAIPDEEVEIPPAAEFPTEDWKTREA
2736|gene|hla       THAWQENIAIDMTLWSRAEYREAFREAGLYVAEQDAIPDREIEIPDASAFPTDSWHSREA
956|gene|nph        THEWQEGIDIDMTLWDYEQYREAFREAGFYVAEQDTIPDRETEIPPEDEFPTDDWERRED
2020|gene|hbo       SHEWQENISVEMTRWTGEEYREAFREAGLFVAEQDNIPDRETEIPDEDEFPTDNWETREA
12440|gene|hma      SHEWQEFIDIEMTRWSADEYREAFREAGLAVAAQDTIPDREVEIPPADTFPTDEFETREA
2873|gene|hhi       SHEWQEFIDIEMTRWSGPEYREAFREAGLAVASQDTIPDREVEIPPADAFPTDEFETREA
                    :  *:: : : *  *    *** ** **: :* *: *.* * :**    ** : :  *  

3733|gene|hwa       MIDRYRTWGTLLTVGVAP-
2398|gene|nrc1      MVERYRTFGTLLTVGVAP-
2258|gene|hut       MVEHFREHGTLLTVGVVP-
2736|gene|hla       MVDRYRTWGTLLTVGVAP-
956|gene|nph        MVERFREFGTLLTVGVAPA
2020|gene|hbo       MVERYRTFGTLLTVGVSH-
12440|gene|hma      MVERYRELGTLLTVGVATE
2873|gene|hhi       MVERYRELGTLLTVGVATE
                    *::.:*  ********