HOG Organism Gene ID Name Annotation
aHOG1795 hla HLAC1702 Hlac_1702 putative circadian clock protein, KaiC
aHOG1795 hut HUTA2353 Huta_2353 putative circadian clock protein, KaiC
aHOG1795 nph NP4694 KaiC-like transcriptional regulator 1
aHOG1795 hma Hma_10131 RecA/helicase-like
MUSCLE (3.6) multiple sequence alignment


4694|gene|nph       MSNPSPTMMQGDSGVVGLNQLLRGGYLRNRMYLIVGTHGTGKTTLCSHFVEAGLDAGETA
10131|gene|hma      MSSSERQFTQLSSGISGLDSLLRGGLVEGRLYLVIGPPGTGKTLLGTQFLEAGLEAGDDV
2353|chp|hut        -----MQLSRLSTGVAGLDAVLDGGLVRGRNVLVRGTPGAGKTIFGLYFLSAGIAADERS
1702|gene|hla       --MSTPLAGRASTGIRGLDEVLSGGLVPERSYMVRGQAGSGKTILSFHFLQQGVDEGETV
                             . .:*: **: :* ** :  *  :: *  *:*** :   *:. *:  .:  

4694|gene|nph       LFVHGEESASELRENAAQFGIDIAGAEFLDLGPDSAFFEKDETYDLVDASEVEGKRYTEQ
10131|gene|hma      LFIHAEESASDLRANTAELGIDISNATFLDVGPDSEFFEEAESYDVVKPRDVEDGHLISD
2353|chp|hut        LYVNLGEPQAYVEETADAFDLQTEGIHFHNLSPTSEQFAEQESYDVFESAEVDQPDFIDS
1702|gene|hla       LFINLEEDLRDLKANAAALGFDTDAIEFLDLSPSADVFVEDDSYEVFAPAEVEREPLTDK
                    *:::  *    :  .:  :.::     * ::.* :  * : ::*::. . :*:     ..

4694|gene|nph       IREAITEIDPDRLVIDPITQLRYIEASDYHYRKRVLSLIRFLKEHEITVLGTTSVSDTHS
10131|gene|hma      IREAIERVDPDRVLIDPITHFQYLEPTEYQFRKRVISFARFLQDRETTVLATKTPSNQMD
2353|chp|hut        LRTVVDEVEPDRVLLDPITEFRYLTSDERQFRKGILGLLDYLKDVGATVMLTSQAGETVT
1702|gene|hla       IVAGVTAVDPDRVVVDPLTQLRFLLSDDYQFRKQVVGFMRFLKDREATVLFTVQNTESLP
                    :   :  ::***:::**:* :.:: . : ::** ::.:  :*::   **: *    :   

4694|gene|nph       TASEILSISDGVVRLSRSET--GRRIEVEKNRGRGQQSGTHGVEIRAHGVEVFPKLTPPE
10131|gene|hma      T--QLRSLSDGIISLSYGDEKAGRRIRLRKHRGIGQQDGSHGMEIRDSGVEVYPALEPEQ
2353|chp|hut        D-EDLQFLVDGVVSLEVVQD--SRAVQVSKFRGSSFRRGKHFYGIDDEGLTVWPRLVPGE
1702|gene|hla       T-DDLEFITDGTIRLDAAEY--GKTVRVPKFRGSATQSGEHAYRVTDSGIEVYPALQPGK
                       ::  : ** : *.  :   .. : : * ** . . * *   :   *: *:* * * :

4694|gene|nph       SPAERRGLDPVATGVGELDSLTGGGFEHGTTTFISGPPGVGKTTVGAYFLFWAAQQGETA
10131|gene|hma      R-TRSFDPTQFSAGVPELDSLLDGGLERGTVTILSGPSGVGKSTTATEFLASAAADGSPA
2353|chp|hut        V-ERSIEDETLSSGVPELDSLLGGGIDRGTVTILSGPTGAGKTTTGVQFLTEAALDKTEG
1702|gene|hla       R-DEDATFEQISSGIPEFDELLHGGIERGTVTVVSGPTGVGKTTLSTQFMKEAAGRGERS
                              .::*: *:*.*  **::.**.*.:***.*.**:* .. *:  **     .

4694|gene|nph       AVYLFEERIETFEKRCRAIGLPIDALRDDGRLKLTRIEPNAMSAEEFANIVRTDVVDGGV
10131|gene|hma      LAYLFDESIDTFSHRCETFGIPLSELRDEGTLLVEEVESLALSPEEFANRVKTQAEERGA
2353|chp|hut        VLFQFEEAERTIRKRADAIGIPLRTVIEEGCLSIVEIEPDEYTVGEFEQLIREAVDD-GV
1702|gene|hla       VIYLFEENKGTFLTRSRAVNIPVDEMMEKGTLQVNEVEALERSPQEFGRMVREEVEERGA
                      : *:*   *:  *. :..:*:  : :.* * :  :*.   :  ** . :.  . : *.

4694|gene|nph       TTAMIDGFSGYTTSI-QGEQDT-LKRDLHALLRHLNELDVAVFMTEAVHQITGLTSATSR
10131|gene|hma      ELVVIDGIAGYKNAIKRGQDDVELRRRLHALTQQLTRGNTAVVLIDQRRDVTGLHEPTSE
2353|chp|hut        ELVMIDGTQGFKQNL-RGLEDP--TAALLRVGRYLRSAGVSTILVNEVHNITGDFRATEE
1702|gene|hla       DIVMIDGIAGYRLTL-RGEEGM-MLQQMHALGRYLKNAGVTAIFVDETRNVTGEFQATME
                      .:***  *:   : .* :.      :  : . *   ..:..: :  .::**   .*  

4694|gene|nph       NISPLADNLLFLTYVELGGSLGRVIGMLKKRTGSFESGIREFEITDEGVQLGAPLDHLQG
10131|gene|hma      NVSYLADNIVFQNYIEVAGELQRVVGALKKRVGGFETVPRRFEITADGLQVGDPVSGMHG
2353|chp|hut        RTSNLADNLVFLRHVEYRGELRKVIGALKMRTSDFEHSLRELEITTDGICVGDPLPQLRG
1702|gene|hla       NISYLADNIVFLRHLEVHGEMRKAIGVLKKRTSDFERTIREFQITSHGLKVGEPMSGMRG
                    . * ****::*  ::*  *.: ..:* ** *...**   * ::**  *: :* *:  :.*

4694|gene|nph       LLEGTPSTRGHRLESS-------DTEP
10131|gene|hma      VFEGVPEQHGDGNNQS-------STH-
2353|chp|hut        ILTGTPDWEETDLPEDTNG----GQD-
1702|gene|hla       ILSGTPEVVDDDRERQRRGVDRESEDC
                    :: *.*.        .       .