HOG Organism Gene ID Name Annotation
aHOG1789 hbo HBOR07720 Hbor_07720 hypothetical protein
aHOG1789 hla HLAC1364 Hlac_1364 hypothetical protein
aHOG1789 hmu HMUK0453 Hmuk_0453 conserved hypothetical protein
aHOG1789 hmu HMUK1579 Hmuk_1579 conserved hypothetical protein
aHOG1789 nph NP3278 hypothetical protein
aHOG1789 nph NP7002 hypothetical protein
aHOG1789 hma Hma_12389 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


7720|hp|hbo       MSGDAIITAPHDGRPALTSISAKAYINTNDETTSSVPEIVATDASDDPPKSKVFDAALTH
3278|hp|nph       MGERTTLRLSDERKHLLDQAS----------------DIVASDPSDDPPRSDVIDAALTH
7002|hp|nph       MGERTTLRLSDERKHLLDQAS----------------DIVASDPSDDPPRSDVIDAALTH
1364|hp|hla       MSRRISLKLTDDREHQIEKAS----------------EIVSSGPEDDPPMSVVIDVALAH
12389|hp|hma      MTRRTSLKITDERQRLLDEAS----------------AIVASDQHDDPPMSDVLDAALTH
                  *     :  . :    : . *                 **::.  **** * *:*.**:*

7720|hp|hbo       LTESEENLQDVRVKYSPQMVKDCCNTQVLGLRYRTSVESRWRR
3278|hp|nph       LIESHENLEDVRDKYPPGEVKDCCNTSVLQLRYRTSIEQRWR-
7002|hp|nph       LIESHENLEDVRDKYPPGEVKDCCNTSVLQLRYRTSIEQRWR-
1364|hp|hla       LIQSEENIHDAREELDPATIQQ-FNTDIIGLRYRTQVTSRWR-
12389|hp|hma      LVESEENIQNAREKLNPETIQQ-FNTSVLGLRYRTSVESRWR-
                  * :* **: :.* :  *  :::  **.:: *****.: .***