HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0178COG0209KOG1112arCOG04276/1Ribonucleotide reductase alpha subunitribonucleoside reductase classs II

HOG Organism Gene ID Name Annotation
cHOG0178 nrc1 VNG1644 nrdj ribonucleoside reductase classs II
cHOG0178 hmu HMUK1766 Hmuk_1766 ribonucleoside-diphosphate reductase, adenosylcobalamin-dependent( EC:1.17.4.1 )
cHOG0178 hma RRNAC1622 nrdA ribonucleoside-diphosphate reductase alpha chain
cHOG0178 hwa HQ2859A nrdA ribonucleoside-diphosphate reductase alpha subunit (intein-containing)
cHOG0178 hla HLAC2376 Hlac_2376 hypothetical protein
cHOG0178 hbo HBOR10740 Hbor_10740 ribonucleoside-diphosphate reductase, adenosylcobalamin-dependent( EC:1.17.4.1 )
cHOG0178 hut HUTA1290 Huta_1290 ribonucleoside-diphosphate reductase, adenosylcobalamin-dependent
cHOG0178 hvo HVO_2452 HVO_2452 ribonucleoside-diphosphate reductase adenosylcobalamin-depen
cHOG0178 nph NP3346A nrdA_2 ribonucleoside-diphosphate reductase, alpha subunit 2
cHOG0178 hhi 2164 nrdA ribonucleoside-diphosphate reductase alpha chain
MUSCLE (3.6) multiple sequence alignment


2376|hp|hla         ------------------------------------------------------------
1644|gene|nrc1      -MSSEDLSADDLTLPVKRVTGDSLEDRLTANAYHNILPARYLRKDTDGEHVESQEDLFER
2859|gene|hwa       -MDTHDVDADELELPIKRTTGETIEQRLTDNAYHNILPARYLRKDAKGDLAESQEEIFER
10740|gene|hbo      -MSRADLSADELVLPIKRTEGETLEDRLTANAYHNILPARYLRKNADGDLTETQEELFAR
1290|gene|hut       -MSDAELAVDEVTLPIKRIEGDTLADRLTDNAYHNILPARYLRKDADGELVEQQEDLFER
3346|gene|nph       MMSGQELSADELTLPIKRTEGDTLEERLTGNAYHNILPARYLRKDADGELIEEQEDLFER
11622|gene|hma      -MSNSDLSADEITLPIKRTDGDTIEERLTGNAYHNILPARYLRKDANGDLIEGPEDLFDR
2164|gene|hhi       -MSNSDLSADEITLPIKRTDGDTIEERLTGNAYHNILPARYLRKDANGDLIEEPEDLFDR
                                                                                

2376|hp|hla         ------------------------------------------------------------
1644|gene|nrc1      VAKNIALAEVVFESDDP---VTATPSQLKPDHPRRDELAAEVFGSDVDPDSETATVELTD
2859|gene|hwa       VAQNVALAEAVFEADKQDTEITVTPDQLKPDHPRRDELAEEVFGAGADAADTVTT-TLSV
10740|gene|hbo      VAKNISLAEAVYEAERQDVEITVTPDQLKPDHPRRDELAAEVFGKGVTAEDDAET-TLSV
1290|gene|hut       VGKNIALAEAVYEARNQDVEITVTPDQLKPDHPRRDELAEEVFGKGTSIGDDAET-TLSV
3346|gene|nph       VAKNVALAEAVFEAEKQGVEVTVTPDQLKPDHPRRDELAAEVFGAGVTADDDAET-ALSV
11622|gene|hma      VAKNIALAEAVFEANKQDVDVHVSPDQLKPDHPRRDELADEVFGKGTSVDDDVET-ELSV
2164|gene|hhi       VAKNIALAEAVFEANKQDVDVHVSPDQLKPDHPRRDELADEVFGKGTSVDDDVET-ELSV
                                                                                

2376|hp|hla         --------------MPD------------------------------LTVGPDMTASLAA
1644|gene|nrc1      SNINKFAYDTVVPELDDPEVREHVEGVAAEFQDLMASLSFMPNSPTLMNAGDELQQLSAC
2859|gene|hwa       YNVNKFAYETIVPELPD-EVQHHVKSVADEFEDLMSRLSFMPNSPTLMNAGDELQQLSAC
10740|gene|hbo      YNVNKFAYDTIVPELPE-EIRTTVKDKRETFQDMMESLSFMPNSPTLMNAGDELQQLSAC
1290|gene|hut       YNVNKFAYETVVPELPA-DVREHVEETATEFQDLMENLSFMPNSPTLMNAGDELQQLSAC
3346|gene|nph       YNVNKFAYDTIVPALPD-EVRDHVEATADAFQEQMESLSFMPNSPTLMNAGDELQQLSAC
11622|gene|hma      YNVNKFAYETVVPELPE-GVRDHVKSTADAFQEQMEQLSFMPNSPTLMNAGDELQQLSAC
2164|gene|hhi       YNVNKFAYETVVPELPE-GVRDHVESTADAFQEQMEQLSFMPNSPTLMNAGDELQQLSAC
                                  :                                :..* ::    *.

2376|hp|hla         FA----------------------------------------------------------
1644|gene|nrc1      FVDSPDDDITDIHQTAKEAAEVFQ------------------------------------
2859|gene|hwa       FVDSPSDDISDIHQTAKEAAEVFQCLTADSTVMLKEKGMVSVSEVETGDQIAQRSDTGFQ
10740|gene|hbo      FVDSPGDDITDIHQTAKEAAEVFQ------------------------------------
1290|gene|hut       FVDSPEDDIDDIHQTAKEAAQVFQ------------------------------------
3346|gene|nph       FVDSPEDDIDDIHQTAKEAAQVFQ------------------------------------
11622|gene|hma      FVDSPGDDIDDIHQTAKEAAQVFQ------------------------------------
2164|gene|hhi       FVDSPADDIDDIHQTAKEAAQVFQ------------------------------------
                    *.                                                          

2376|hp|hla         ------------------------------------------------------------
1644|gene|nrc1      ------------------------------------------------------------
2859|gene|hwa       YKPVEETHAYENAETLTVTLTNGCSIRGTPNHRLMVDDEWTRIDEIQPDQEVHYTLGWLR
10740|gene|hbo      ------------------------------------------------------------
1290|gene|hut       ------------------------------------------------------------
3346|gene|nph       ------------------------------------------------------------
11622|gene|hma      ------------------------------------------------------------
2164|gene|hhi       ------------------------------------------------------------
                                                                                

2376|hp|hla         ------------------------------------------------------------
1644|gene|nrc1      ------------------------------------------------------------
2859|gene|hwa       ETNQSPPKLHSQSHTTVNQTADSISPDSSEPIELSESENADTGNRHNSAVAVKQSRTQTQ
10740|gene|hbo      ------------------------------------------------------------
1290|gene|hut       ------------------------------------------------------------
3346|gene|nph       ------------------------------------------------------------
11622|gene|hma      ------------------------------------------------------------
2164|gene|hhi       ------------------------------------------------------------
                                                                                

2376|hp|hla         ------------------------------------------------------------
1644|gene|nrc1      ------------------------------------------------------------
2859|gene|hwa       LISDEVVSRPEHTRRPDQLSEELAELLGLWIDTGLWHQSGVQFNVERENIAEYIDQLSQQ
10740|gene|hbo      ------------------------------------------------------------
1290|gene|hut       ------------------------------------------------------------
3346|gene|nph       ------------------------------------------------------------
11622|gene|hma      ------------------------------------------------------------
2164|gene|hhi       ------------------------------------------------------------
                                                                                

2376|hp|hla         ------------------------------------------------------------
1644|gene|nrc1      ------------------------------------------------------------
2859|gene|hwa       LFDTPAAISDTDGTYTVDITDHKLKEWWKANFGGKPDGTQSSYVPQMIKEAPTNVIEAFL
10740|gene|hbo      ------------------------------------------------------------
1290|gene|hut       ------------------------------------------------------------
3346|gene|nph       ------------------------------------------------------------
11622|gene|hma      ------------------------------------------------------------
2164|gene|hhi       ------------------------------------------------------------
                                                                                

2376|hp|hla         ------------------------------------------------------------
1644|gene|nrc1      ------------------------------------------------------------
2859|gene|hwa       RGCFTAEGGLRKDMRPRLCTSSEDSIDDIAVLMMGLGYPVEKSVIRNADGEPYYSVMPAT
10740|gene|hbo      ------------------------------------------------------------
1290|gene|hut       ------------------------------------------------------------
3346|gene|nph       ------------------------------------------------------------
11622|gene|hma      ------------------------------------------------------------
2164|gene|hhi       ------------------------------------------------------------
                                                                                

2376|hp|hla         ------------------------------------------------------------
1644|gene|nrc1      ------------------------------------------------------------
2859|gene|hwa       DDGLSAFLHDVGFIDERREIGLSNIESSDSRALNNTHKIEVESIVESPPATVYDITVADN
10740|gene|hbo      ------------------------------------------------------------
1290|gene|hut       ------------------------------------------------------------
3346|gene|nph       ------------------------------------------------------------
11622|gene|hma      ------------------------------------------------------------
2164|gene|hhi       ------------------------------------------------------------
                                                                                

2376|hp|hla         ------------------------------------------------------------
1644|gene|nrc1      ------------SGGGMGYAFWQLRPYGDTVGSTGGIASGPLTFMETFDQMCETIAQGGA
2859|gene|hwa       HEYVTDGIISHNSGGGMGYAFWKLRPYGDSVGSTGGIASGPITFMRTYDQMCETIAQGGA
10740|gene|hbo      ------------SGGGMGYAFWKLRPYGDAVGSTGGIASGPITFMRTYDQMCETIAQGGA
1290|gene|hut       ------------SGGGMGYAFWRLRPYGDAVGSTGGIASGPITFMRTFDQMCETIAQGGA
3346|gene|nph       ------------SGGGMGYAFWRLRPYGDAVGSTGGIASGPITFMRTYDQMCETIAQGGA
11622|gene|hma      ------------SGGGMGYAFWKLRPYGDPVGSTGGIASGPITFMRTYDQMCETIAQGGA
2164|gene|hhi       ------------SGGGMGYAFWKLRPYGDPVGSTGGIASGPITFMRTYDQMCETIAQGGA
                                                                                

2376|hp|hla         ------------------------------------------------------------
1644|gene|nrc1      RRGAQMAVMRVSHPDVVEFIHAKNKDVSLAQTLKLNDPDDYTYTEFSEALEEARDLIDED
2859|gene|hwa       RRGAQMGVMRISHPDVIQFIHAKNKDVSLAHSLRLNDPDDFTHTSFADALEEARELIDEE
10740|gene|hbo      RRGAQMGVMRVSHPDVIQFIHAKNKDVSLAHSLRLNDPDDFTHNSFADALEEARELIDDE
1290|gene|hut       RRGAQMGVMRVSHPDVIQFIHAKNKDVSLARTLRLNDPDDFTHTSFSDALEEARELIDDD
3346|gene|nph       RRGAQMGVMRISHPDVIQFIHAKNKDVSLAETLRLNDPDDFTHNSFQEALEEARELIDED
11622|gene|hma      RRGAQMGVMRVSHPDVIQFIHAKNKDVSLAETLRLNDPDDFTHNSFAEALEEARELIDDD
2164|gene|hhi       RRGAQMGVMRVSHPDVIQFIHAKNKDVSLAETLRLNDPDDFTHNSFAEALEEARELIDDD
                                                                                

2376|hp|hla         ---------------SSLPLQAGL-------------------------LASQAGQLLVA
1644|gene|nrc1      GRVPEHLRNAVEGHLSNFNISVGVTDGFMEALEAGEEYTFTNPRTGEAHIATEETKEMYS
2859|gene|hwa       GRVPEHLRNAVEGHLSNFNISVGVTDEFMEALFADEEFTFTNPRTEDPHIATPETKELYE
10740|gene|hbo      GRVPKHLRNAVEGHLSNFNISVGITDDFMEALENGEEFVFTNPRTEEPHIATPETKEIYE
1290|gene|hut       GRVPEHLRNAVEGHLSNFNISVGITDEFMDALQNDEEFTFTNPRTGDPHIVTAETKELYD
3346|gene|nph       GKVPKHLRNAVEGHLSNFNISVGVTDGFMEALKNGEEFTFTNPRTDEPHIATPETKELYD
11622|gene|hma      GQVPKHLRNAVEGHLSNFNISVGVTDDFMEALKAGEEFTFTNPRTGDAHIVTEETKELYD
2164|gene|hhi       GKVPKHLRNAVEGHLSNFNISVGVTDDFMEALKAGEEFTFTNPRTGEAHIATEETKELYD
                                   *.: :..*:                         :.:   : :  

2376|hp|hla         LVAVAIIIVVGK--------------------------FVLKLA----------------
1644|gene|nrc1      RYGLGHYVTPGEELTLPAEELWSRIVEGAHENGEPGVIYLERVNDEHSFDVEEHPDHRIL
2859|gene|hwa       LHDLGEHVEVGEELSVPAEELWDHIVSGAHENGEPGVIYLERVNKEHSFDVEKHSEHEIL
10740|gene|hbo      MFGLGEHVEVGEVLSVPAEKLWDQMVDGAYENGEPGVIYLERVNKQHSFDVEKHPEHRIL
1290|gene|hut       MFGLGEYVEVGEELSIPASELWDDIVEGAHENGEPGVIYLERANKEHSFDVEENSDHRIL
3346|gene|nph       MFGLGDHVEVGEELSIPATKLWEHMIEGAHENGEPGVIYLERVNKEHSFDVEEHPDHQIL
11622|gene|hma      MFGLGEHVEVGEELSIPAEELWDDIVEGAHENGEPGVIYLERVNKQHSFDVEEHPDHEIL
2164|gene|hhi       MFGLGEHVEVGEELSIPAEELWDDIVEGAHENGEPGVIYLERVNKQHSFDVEEHPDHEIL
                       :.  :  *:                          :: .                  

2376|hp|hla         ---------------------------------WRL------------------------
1644|gene|nrc1      ATNPCGEQPLEEYEACNLGHINLSTLAAQDAPDWRVWSQTH--DFDTLEAGVSRFLDEAM
2859|gene|hwa       ATNPCGEQPLEEYEACNLGHINLSTLADKDAPDWRVWYDNNGDAYNNLDDAAEAFIYEAI
10740|gene|hbo      ATNPCGEQPLEEYEACNLGHINLSTLADLDAPDWRVWQAENGDDYDSIEDAVDAFLEEAI
1290|gene|hut       ATNPCGEQPLEEYEACNLGHINLSTLAAEGAPDWRVWSERHADDYDDFEAAVEAYLDEAI
3346|gene|nph       ATNPCGEQPLEEYEACNLGHINLSTLADLDAPDWRVWYDEHGDDYETLADAVDAFLEEAI
11622|gene|hma      ATNPCGEQPLEEYEACNLGHINLSTLAATDAPDWRVWSEAHADEYDSIDAAIDAFLEEAI
2164|gene|hhi       ATNPCGEQPLEEYEACNLGHINLSTLAATDAPDWRVWSEAHADEYDSTEAAIDAFLEDAI
                                                     **:                        

2376|hp|hla         ---------------------------------------VTIGIVLVAAFFLLS------
1644|gene|nrc1      DTDAFQRRIEMGTRFLENVVTMSDFPVPEIEQKVSEMRKIGLGVMGLAQLYIQLGVKYGS
2859|gene|hwa       DMNAFNRRIESGTRFLENVVTMSDFPVDEIEATVRDMRKIGLGIMGLAQLYIQIGVRYGS
10740|gene|hbo      DWEEFDHRIDNGTRFLENVVTMSDFPVEKIEEKVRAMRKIGLGVMGLAQLYIQLGIRYGS
1290|gene|hut       DVEELEYRIEMATRFLENVVTMSDFPVEKIEEKVRDMRKIGLGIMGLAQLFIQLGVKYGS
3346|gene|nph       DFEALDGRIELGTRFLENVVTMSDFPVDKIEQKVREMRKIGLGVMGLAQLYIQLGIKYGS
11622|gene|hma      DWDEFDRRIELGTRFLENVVTMSDFPVEKIEQKVREMRKIGLGIMGLAQLYIQLGVAYGT
2164|gene|hhi       DWDEFDRRIELGTRFLENVVTMSDFPVEKIEQKVREMRKIGLGIMGLAQLYIQLGVAYGT
                                                           : :*:: :* :::        

2376|hp|hla         ------------------------------------------------------------
1644|gene|nrc1      EEGNEIASQLMQTINHDSKTASHELALERGSFDEWDNSKFAAPTEYADWFEHHTGEDAAD
2859|gene|hwa       QEANAIAEQLMTHINHESKWASHELAKERGTFNDWTESKYANPTEYREWFEHHTGLDASE
10740|gene|hbo      DSGNEVARQLMTHINHQSKWASHELAEERGTFEDWDDSKFADPTEYREWFEHHTGLDADE
1290|gene|hut       DEGDAIAGHLMQKINHDSKWASHELAEERGVFNDWEDSKYADPTEYREWFEHYVGEDADD
3346|gene|nph       EEGNEVARQLMRHINHGSKWTSHELAEERGVFDEWDKSKYANPAEYREWFEKQTGLDADE
11622|gene|hma      EEANEIARQTMRHINHGSKAASHELAEERGVFTEWENSKYANPTDYSDWFEKQTGEDAAD
2164|gene|hhi       EEANEIARQTMRHINHGSKAASHELATERGTFEEWDNSKYANPTDYPEWFEKQTGEDAED
                                                                                

2376|hp|hla         ------------------------------------------------------------
1644|gene|nrc1      WADGYPIRNHNTTTIAPTG-----------------------------------------
2859|gene|hwa       WEDGFLIRNHNTTTIAPTGCVEENSLVSTDEGLRPIKDLDNTTAEFEQWDEIDVGVTTDG
10740|gene|hbo      WEDGFPIRNHNTTTIAPTG-----------------------------------------
1290|gene|hut       WAEGFPIRNHNTTTIAPTG-----------------------------------------
3346|gene|nph       WADGFAIRNHNTTTIAPTG-----------------------------------------
11622|gene|hma      WEDGYPIRNHNTTTIAPTG-----------------------------------------
2164|gene|hhi       WADGYPIRNHNTTTIAPTG-----------------------------------------
                                                                                

2376|hp|hla         ------------------------------------------------------------
1644|gene|nrc1      ------------------------------------------------------------
2859|gene|hwa       GTKTATAVYDNGFANVRQIQTESGFNIAATPNHRFRTLSSDGTYTWKEAGKFESGDRVIL
10740|gene|hbo      ------------------------------------------------------------
1290|gene|hut       ------------------------------------------------------------
3346|gene|nph       ------------------------------------------------------------
11622|gene|hma      ------------------------------------------------------------
2164|gene|hhi       ------------------------------------------------------------
                                                                                

2376|hp|hla         ------------------------------------------------------------
1644|gene|nrc1      ------------------------------------------------------------
2859|gene|hwa       QRNTFDAGSRVSLEANERADDAQDTTEGPELPGRMTSELAEFLGYFMGSGYISDETHASV
10740|gene|hbo      ------------------------------------------------------------
1290|gene|hut       ------------------------------------------------------------
3346|gene|nph       ------------------------------------------------------------
11622|gene|hma      ------------------------------------------------------------
2164|gene|hhi       ------------------------------------------------------------
                                                                                

2376|hp|hla         ------------------------------------------------------------
1644|gene|nrc1      ------------------------------------------------------------
2859|gene|hwa       DLVVDSDATELNSYLSNLGEQLFRITPAVESQEMSQVLSFRDCHLSRYFEDNGWKKTDTG
10740|gene|hbo      ------------------------------------------------------------
1290|gene|hut       ------------------------------------------------------------
3346|gene|nph       ------------------------------------------------------------
11622|gene|hma      ------------------------------------------------------------
2164|gene|hhi       ------------------------------------------------------------
                                                                                

2376|hp|hla         ------------------------------------------------------------
1644|gene|nrc1      ------------------------------------------------------------
2859|gene|hwa       HNGDASAAFVPEQILEGDEQVVNGFLRGVFEAIGTVSEKIEILTTSTTLADQLQSLLLSL
10740|gene|hbo      ------------------------------------------------------------
1290|gene|hut       ------------------------------------------------------------
3346|gene|nph       ------------------------------------------------------------
11622|gene|hma      ------------------------------------------------------------
2164|gene|hhi       ------------------------------------------------------------
                                                                                

2376|hp|hla         ------------------------------------------------------------
1644|gene|nrc1      ------------------------------------------------------------
2859|gene|hwa       GHVFTRDSTKLVETNNYHDDQLRQRLCGATRREDERFMNEIGSLIEPDELNLSTRADKND
10740|gene|hbo      ------------------------------------------------------------
1290|gene|hut       ------------------------------------------------------------
3346|gene|nph       ------------------------------------------------------------
11622|gene|hma      ------------------------------------------------------------
2164|gene|hhi       ------------------------------------------------------------
                                                                                

2376|hp|hla         ------------------------------------------------------------
1644|gene|nrc1      ------------------------------------------------------------
2859|gene|hwa       TYPSSVIDHVQTLDGYDSVSESLKSRINQSQVDGTVSRKLIKDIEAETAETVSIADHELT
10740|gene|hbo      ------------------------------------------------------------
1290|gene|hut       ------------------------------------------------------------
3346|gene|nph       ------------------------------------------------------------
11622|gene|hma      ------------------------------------------------------------
2164|gene|hhi       ------------------------------------------------------------
                                                                                

2376|hp|hla         -------------------------------------TAGLV------------------
1644|gene|nrc1      -------------------------------------TTSMVGNTTGGCEPIYNVAYYKN
2859|gene|hwa       GFYAATVESVTEDTAYTKDISVPSNNTYIADGFVTHNTTSMIGNTTGGCEPIYNVAYYKN
10740|gene|hbo      -------------------------------------TTSMVGNTTGGCEPIYNVAYYKN
1290|gene|hut       -------------------------------------TTSMVGNTTGGCEPVYNVAYYKN
3346|gene|nph       -------------------------------------TTSMVGNTTGGCEPIYNVAYYKN
11622|gene|hma      -------------------------------------TTSMIGNTTGGCEPIYNVAYYKN
2164|gene|hhi       -------------------------------------TTSMIGNTTGGCEPIYNVAYYKN
                                                         *:.::                  

2376|hp|hla         ------------------------------------------------------------
1644|gene|nrc1      VSDDVQGDEMLVEFDDYFLRTLEDNDIDVQAVKEEAQTQMANNDFDGVDGLTTVPDAIGE
2859|gene|hwa       VSDDVQGDEMLVEFDDYFLRVLEQNDIDVEAVKQEAQEQMANNDFDGVDGLDTVPKAIGE
10740|gene|hbo      VSDDVQGDEMLVEFDDYFLRVLEANDIDVDAVKEEAQEQMANNEFDGVEGLETVPNAIGE
1290|gene|hut       VSDDVQGDEMLVEFDDYFLRVLEENGIDVETVKEEAQEQMATNEFDGVEGLSTVPDAIGE
3346|gene|nph       VSDDVQGDEMLVEFDDYFLRVLEENGLDVEAVKEEAQEQMATNEFDGIDGLSTVPDAIGE
11622|gene|hma      VSDDVQGDEMLVEFDDYFLRALEDNDIDVEAVKQEAQEQMANNEFDGVDGLTTVPDAIGE
2164|gene|hhi       VSDDVQGDEMLVEFDDYFLRALEDNDIDVEAVKQEAQEQMANNEFDGVDGLTTVPDAIGE
                                                                                

2376|hp|hla         ------------------------------------------------------------
1644|gene|nrc1      LFVVTSDLSGKDHAAVQTACQNGVDSAISKTCNFPNDASVEDMDEVYRYIYDNGGKGVTV
2859|gene|hwa       LFVVTSDLSGKDHAGVQCACQEGIDSAISKTCNFPSSATKEDMDEVYRYIYQNGGKGVTV
10740|gene|hbo      LFVVTSDLSGKDHAAVQCACQKGVDSAISKTCNFPNSASKEDMDEVYRYIYNNGGKGVTV
1290|gene|hut       LFVTTGDLSPKQHASIQCTLQDGVDSAISKTVNAPNDSTIEDAKDVFEYIYEHGGKGVTY
3346|gene|nph       LFVTTGALSAKQHAGVQVACQEGVDSAISKTVNAPNDSTVEDAKDVFEYIYDHGGKGVTY
11622|gene|hma      LFVTTGDLSAKQHAGIQVACQEGVDSAISKTVNAPNDSTTEDAAEVFEYIYDHGGKGVTY
2164|gene|hhi       LFVTTGDLSAKQHAGIQVACQEGVDSAISKTVNAPNDSTTEDAAEVFEYIYDHGGKGVTY
                                                                                

2376|hp|hla         ------------------------------------------------------------
1644|gene|nrc1      YRDGTRSKQVLTTRADNTEFSGLDEEEAAAAMVDTIQETFGGIEGFLENDDIQDAFGADL
2859|gene|hwa       YRDGTRSKQVLTTRAQNTEFADES--EAAETLVEQIEDVFGDVDSFLDNDTVRATVDDEI
10740|gene|hbo      YRDGTRSKQVLTTRAKNTDFADEG--EAAETLIEQIEDVFGGIEGFLENEEVRNALDGEI
1290|gene|hut       YRDGTRSKQVLTTRAENTDFADMD----TEEVIAQIEAVFGGIEAFLDDEDVRAALDGEI
3346|gene|nph       YRDGTRSKQVLTTRAQNTEFADMDEAEAAEAIVENIEEIFGGIDGFLESDEVASAVETDL
11622|gene|hma      YRDGTRSKQVLTTRAQNTEFSDMD----ADEIVAQIEEVFGGIEGFLEDEAVQAAIDDSI
2164|gene|hhi       YRDGTRSKQVLTTRAQNTEFSDMD----ADEIVAQIEEVFGGIEGFLEDEAVQAAIDDSI
                                                                                

2376|hp|hla         ------------------------------------------------------------
1644|gene|nrc1      RELFATGDDAAFDEEDFAEKQPRPDLLHGVTQRVDTGYGKLYVTINENPERERPFELFAN
2859|gene|hwa       DRVLAAADG---NV-ELGKKRPRPDVLHGVTQRIDTGYGKLYVNINED-DAGRPFELFAN
10740|gene|hbo      ERLLAAADG----EVDLGKKQPRPDVLYGVTQRIDTGYGKLYVNINED-ANERPFELFAN
1290|gene|hut       ETLLGEADG---EYADYAKKRPRPDVLHGVTQRIDTGYGKVYVNINEDPEAERPFELFAN
3346|gene|nph       SELFET------DY-DLGKKRPRPDVLRGVTQRIDTGYGKLYVNINEDPETGRPFELFAN
11622|gene|hma      QQVLGVADG---DA-EYAEKQTRPDVLHGVTQRIDTGYGKLYVNINEDPEADRPFELFAN
2164|gene|hhi       QQVLGVADG---DA-EYAEKQTRPDVLHGVTQRIDTGYGKLYVNINEDPETDRPFELFAN
                                                                                

2376|hp|hla         ------------------------------------------------------------
1644|gene|nrc1      TGNSGGFTGSFTEALAKTISVALRSGVDPDEIADKLQGIRSPKVAWDKGEQVNSIPDAFG
2859|gene|hwa       IGNSGGFTASFTEALAKTVSTALRSGVDPREIASELQGIRSPKVAWDKGEQINSIPDAVG
10740|gene|hbo      IGNSGGFTASFTEALAKTISTALRSGVDPEEIASELQGIRSPKVAWDKGEQINSIPDAIG
1290|gene|hut       IGNSGGFTASFTEALAKTVSAALRAGVDPNEIAGELQGIRSPKVAWDKGEQIQSIPDAIG
3346|gene|nph       IGNSGGFTASFTEALAKTISTALRSGVDPEEIADELQGIRSPKVAWDKGEQINSIPDAIG
11622|gene|hma      IGNSGGFTASFTEALAKTISTALRSGVDPEEIADELQGIRSPKVAWDKGEQIQSIPDAIG
2164|gene|hhi       IGNSGGFTASFTEALAKTISTALRSGVDPEEIADELQGIRSPKVAWDKGEQIQSIPDAIG
                                                                                

2376|hp|hla         ------------------------------------------------------------
1644|gene|nrc1      TALRRYLNGDVDRAAYPQQQHLTEIDADD---------------AAHHETDGGA--AESL
2859|gene|hwa       TAMRRYLDGEIEK-GYPQQQNLTEVGTDTGSEPRVESGSGSDAKAPGHETDGGAAVTDDT
10740|gene|hbo      TAMRRYLDGEIDK-GYPQQQNLTEVSEEAGADVEG---------TDAPEPDGGA------
1290|gene|hut       TAMRRYLDGDIER-AYPQQQTLEETADEEDPE------------AMGHSTDGGA------
3346|gene|nph       TAMRRYLDGEIDK-AYPDQATLDQTAKQAE--------------ETARETDGGA------
11622|gene|hma      TALRRYLDGDVDK-AYPDQTTLEETAEKAEGET-----------ATQTQTDGGA------
2164|gene|hhi       TALRRYLDGDVDK-AYPDQTTLEETAEKADGET-----------ATQTQTDGGA------
                                                                                

2376|hp|hla         ------------------------------------------------------------
1644|gene|nrc1      GGPQGPTGAGESADAQQQSQDATQSLIDAGESPECPECGAMTLYYSEGCKTCESCGWSEC
2859|gene|hwa       VSTNRNNGSLPSANDENNDTDDVDSLVAAGESPECPECGSMSLYYSEGCKTCESCGWSEC
10740|gene|hbo      ----SVADDPNGEPGVQSENDAMDDLLAAGESPECPDCGNMTLYYSEGCKTCESCGWSEC
1290|gene|hut       ------TTAPSESVEPTEPSGDQQELIENGESPECPECGSMSLYYSEGCKTCESCGWSEC
3346|gene|nph       --VSAPTGGSMEAASPNDDTDATQSLIDSGESPECPECGSMSLYYSEGCKTCESCGWSEC
11622|gene|hma      -------------AAAADAGGDQQDIIDAGESPECPDCGSLSLYYSEGCKTCESCGWSEC
2164|gene|hhi       ------------AAAASDAGGDQQDIIDAGESPECPDCGSLSLYYSEGCKTCESCGWSEC