HOG Organism Gene ID Name Annotation
aHOG1777 hbo HBOR06110 Hbor_06110 hypothetical protein
aHOG1777 hla HLAC1540 Hlac_1540 hypothetical protein
aHOG1777 nph NP2496 hypothetical protein
aHOG1777 hma Hma_12061 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


6110|hp|hbo       MTTT-----------------------VPLDGDVLLLAGARASVTPNQLPDLVHRAQSYL
2496|hp|nph       MSGD------------------------PLDGNALVLAAAKASVSGEQLPKLVDDAQSRL
1540|hp|hla       -MADDETPSDDRSDGDSTDGDSGSPGPYPIEGTALVKTAALASVPAERLPELLARVQADL
12061|hp|hma      -MAD---PS------------------YPIEGQIVLLAGTQASVPLDRLPDLLEQVQTYL
                                              *::*  :: :.: ***. :.**.*:  .*: *

6110|hp|hbo       VQRTAEYDRRFECIYDDADRSVFLVPKDHWAELGSELELENREADALRRAHEQQLLRIGT
2496|hp|nph       ADRRDAYRRRYECVHDDDDRTVFLVEEGHWQTLGDEWGLDDQAWRALRRAHREQLGQLAG
1540|hp|hla       GPRLDEYRRRYERIAAEPDRETFLVESDHWEGVADRLGLSDRERDAAARAHEAAVERAGG
12061|hp|hma      RANRETYDREYERISGPREADYVCAESDHWDSIGTELGLSNREQDAVQRAHAAQFERDGR
                    .   * * :* :    :   . . ..**  :.    *.:.   *  ***   . . . 

6110|hp|hbo       KHGRRDEFESAMEIREAVVVGR-------
2496|hp|nph       DLDRRQEFDAALELREVVVIGTEQSVPG-
1540|hp|hla       S-DQRAEFETALEIRSGVVIGVPDNRNEE
12061|hp|hma      RLDRSEEFETTLEIRAVLAVSSEP-----
                    ..  **::::*:*  :.:.