HOG Organism Gene ID Name Annotation
aHOG1776 hbo HBOR06090 Hbor_06090 molybdopterin synthase subunit MoaD
aHOG1776 hla HLAC1542 Hlac_1542 MoaD family protein
aHOG1776 nph NP2500 moaD_2 molybdopterin converting factor, small subunit 2
aHOG1776 hma Hma_12057 moaD molybdopterin converting factor subunit 1
MUSCLE (3.6) multiple sequence alignment


12057|gene|hma      MQIELRFFANFREAVGQKTVHREYETDLQAGDVLRQLSEEFTEM--DLF-EDGELREYLT
1542|gene|hla       MELELRFFATFREAAGGKIVEAEFADGSSVGDVLRELEAGYEGMNGRLI-VDGGLAPQIN
6090|gene|hbo       ----MRFFANFREAVGTKTIERDYEV-TTVGDALRELEAEYSGLAGELL-EDGHVRPQVN
2500|gene|nph       MQLALRFFATFREAVGTKEIERTFDAEATVGDVLAAVEDEFPELAGDILDDDGDIQPHLT
                        :****.****.* * :   :     .**.*  :.  :  :   ::  ** :   :.

12057|gene|hma      ILRNGRDIAHLDGLETPLEDGDELSVFPPVAGG---
1542|gene|hla       VLKNGREVLHLDGLDTSLDDGDRLSVFPPVAGGCEV
6090|gene|hbo       VLLNGRDVQHEQGIETELGDEDTLSIFPPVAGGMRD
2500|gene|nph       VLRNGREVVHLDGTATELSDGDRLSIFPPVAGG---
                    :* ***:: * :*  * * * * **:*******