HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0177COG0504KOG2387arCOG00063CTP synthase (UTP-ammonia lyase)CTP synthase

HOG Organism Gene ID Name Annotation
cHOG0177 nrc1 VNG1830 pyrG CTP synthase
cHOG0177 hmu HMUK1393 Hmuk_1393 CTP synthase( EC:6.3.4.2 )
cHOG0177 hma RRNAC3471 pyrG CTP synthetase
cHOG0177 hwa HQ3195A pyrG CTP synthetase
cHOG0177 hla HLAC2594 Hlac_2594 CTP synthase
cHOG0177 hbo HBOR09500 Hbor_09500 CTP synthase( EC:6.3.4.2 )
cHOG0177 hut HUTA0427 Huta_0427 CTP synthase
cHOG0177 hvo HVO_2624 HVO_2624 pyrG CTP synthase
cHOG0177 nph NP1968A pyrG CTP synthetase
cHOG0177 hhi 694 pyrG CTP synthetase
MUSCLE (3.6) multiple sequence alignment


1830|gene|nrc1      ------------------------MPTE--TEYDPSLGSKFVFVTGGVMSGLGKGITAAS
3195|gene|hwa       ------------------------MPKEPETEYDPSLGRKFIFVTGGVMSGLGKGITAAS
2594|gene|hla       ------------------------MPTDPDTGYDPSLGRKFVFVTGGVMSGLGKGITAAS
2624|gene|hvo       ------------------------MPTD---EYDPEMGRKFIFVTGGVMSGLGKGITAAS
9500|gene|hbo       ------------------------MPKEPETGYDPSLGRKFIFVTGGVMSGLGKGITAAS
427|gene|hut        ------------------------MPNEPETDYDPELGRKFIFVTGGVMSGLGKGITAAS
1968|gene|nph       ------------------------MPTEL-TDYDPSMGNKFIFVTGGVMSGLGKGITAAS
13471|gene|hma      ------------------------MPTEPETDYDPELGRKFIFVTGGVMSGLGKGITAAS
694|gene|hhi        MTLRRGGEQCALRNRLDYAGFTVGMPTEPETDYDPELGRKFIFVTGGVMSGLGKGITAAS
                                            **.:    ***.:* **:******************

1830|gene|nrc1      LGRLLSNAGFDVTAVKIDPYLNVDAGTMNPYQHGEVYVLDDGGEVDLDLGNYERFLDEDM
3195|gene|hwa       TGRLLSNAGFDVTAVKIDPYLNVDAGTMNPYQHGEVYVLKDGGEVDLDLGNYERFLGEDM
2594|gene|hla       TGRLLANAGFDVTAVKVDPYLNVDAGTMNPYEHGEVYVLKDGGEVDLDLGNYERFLGTDM
2624|gene|hvo       TGRLLKNAGFDVTAVKIDPYLNVDAGTMNPYEHGEVYVLKDGAEVDLDLGNYERFLGIDM
9500|gene|hbo       TGRLLSNAGFDVTAVKIDPYLNVDAGTMNPYQHGEVYVLKDGGEVDLDLGNYERFLGEDM
427|gene|hut        TGRLLANAGFDVTAVKIDPYLNVDAGTMNPYQHGEVYVLKDGGEVDLDLGNYERFLDIDM
1968|gene|nph       TGRLLANAGFDVTAVKIDPYLNVDAGTMNPYQHGEVYVLKDGGEVDLDLGNYERFLDIDM
13471|gene|hma      TGRLLKNAGFDVTAVKIDPYLNVDAGTMNPFQHGEVYVLKDGGEVDLDLGNYERFLDIDM
694|gene|hhi        TGRLLKNAGFDVTAVKIDPYLNVDAGTMNPFQHGEVYVLKDGGEVDLDLGNYERFLDIDM
                     **** **********:*************::*******.**.*************. **

1830|gene|nrc1      TSDHNVTTGKVYQDVIERERSGDYLGKTVQIIPHVTDDIKRRVREAAEGSDVCLVEVGGT
3195|gene|hwa       TSDHNVTTGKTYKHVIEKERSGDYLGKTVQIIPHITDDIKRRIREAAAGTDVCIVEVGGT
2594|gene|hla       TFDHNVTTGKTYQHVIERERAGDYLGKTVQIIPHVTDDIKRRIREAAEGSDVCLIEIGGT
2624|gene|hvo       TADHNITTGKTYQHVIQKERDGDYLGKTVQIIPHVTEDIKRRIREAAEGTDVCIVEVGGT
9500|gene|hbo       TSDHNVTTGKTYQHVIEKERAGDYLGKTVQIIPHVTDDIKRRIREAAEGTDVCIVEVGGT
427|gene|hut        TSDHNVTTGKVYREVIEKERAGDYLGRTVQIIPHITDDIKRRIREVAEGSDVCIIEVGGT
1968|gene|nph       TFDHNITTGKTYRHVIEKERAGDYLGKTVQIIPHVTDDIKRRIREAAEGHDVCIIEVGGT
13471|gene|hma      TFDHNVTTGKTYQHVIEKERSGDYLGRTVQIIPHITDDIKRRIREAAEGNDVCIIEVGGT
694|gene|hhi        TFDHNVTTGKTYQHVIEKERSGDYLGRTVQIIPHITDDIKRRIREAAEGNDVCIIEVGGT
                    * ***:****.*. **:.** *****.*******:*:*****:**.* * ***::*:***

1830|gene|nrc1      VGDIEGMPFLEALRQFSHEQDDEDILFTHVTLVPYSKNGEQKTKPTQHSVKELRSIGLQP
3195|gene|hwa       VGDIEGMPYLEALRQFAHEEASENILFTHVTLVPYSKNGEQKTKPTQHSVKELRSIGLQP
2594|gene|hla       VGDIESMPFLEALRQFAHEEDDEDILFTHVTLVPYSKNGEQKTKPTQHSVKELRSIGLQP
2624|gene|hvo       VGDIESMPFLESLRQFASEEEDGDVLFTHVTLVPYSKNGEQKTKPTQHSVKELRSIGLQP
9500|gene|hbo       VGDIEGMPFLEALRQFAHEEDDDDILFTHVTLVPYSKNGEQKTKPTQHSVKELRSIGLQP
427|gene|hut        VGDIEGMPYLEALRQFAHEEDEDDILFTHVTLVPYSKNGEQKTKPTQHSVKELRSIGLQP
1968|gene|nph       VGDIEGMPYLEALRQFAHEEDDDDILFTHVTLVPYSKNGEQKTKPTQHSVKELRSIGLQP
13471|gene|hma      VGDIEGMPYLEALRQFAHEEDEDDILFTHVTLVPYSKNGEQKTKPTQHSVKELRSIGLQP
694|gene|hhi        VGDIEGMPYLEALRQFAHEEDEDDILFTHVTLVPYSKNGEQKTKPTQHSVKELRSIGLQP
                    *****.**:**:****: *: . ::***********************************

1830|gene|nrc1      DILVGRCEDRLDPDVREKIALFCDVPMDAVFSNPDVEDIYHVPLTVEEEGLDQYVMEQFD
3195|gene|hwa       DILVGRCSDRLEPATKEKIALFCDVPTTAVFSNPDVDDIYHVPLVIEEEGLDQHVMERLN
2594|gene|hla       DILVGRSEDRLDPETKEKIALFCDVPTDAVFSNPDVKDIYHVPLMVEDEGLDEYVMERLG
2624|gene|hvo       DILVGRADDKLEPATKSKIAQFCDVPDAAVFSNPDVPDIYHVPLMVEEEGLDEYVMERLG
9500|gene|hbo       DILVGRSPDKLDASTKEKIALFCDVPTEAVFSNSDVEDIYHVPLMVEEEGLDEYVMEQLS
427|gene|hut        DILVGRCDDKLEADVKEKIALFCDVPTDAVFSNPDVADIYKVPLVVEDEGLDQYVMDALD
1968|gene|nph       DILVGRCEDKLDIEAKEKIALFCDVPMDAVFSNPDVEDIYHVPLMVEEEGLDQYVMEQLG
13471|gene|hma      DILVGRCSDKLDIDTKEKIGLFCDVPTEAVFSNPDVDDIYHVPLMVEEEGLDQYVMEELD
694|gene|hhi        DILVGRCSDKLDIDTKEKIALFCDVPTEAVFSNPDVDDIYHVPLMVEEEGLDQYVMEELD
                    ******. *.*:  ...**. *****  *****.** ***:*** :*:****::**: :.

1830|gene|nrc1      MVEDALPAAQRSTEWRDLVTRERTGEVDIALVGKYALEDAYMSIHEALKHASLEAGVEVN
3195|gene|hwa       VAEEAITTTDRTNTWRELVTRERTSSVDVALVGKYDLEDAYMSVHEALKHAGIETQTEVT
2594|gene|hla       LADEALPKAERSTEWRELVTRDRDKEIDVALVGKYALEDAYMSIHEALKHAGIHTETEVN
2624|gene|hvo       IADEALPKAERDNRWRELVTADRTGSVDIALVGKYALEDAYMSIHEALKHAGIECGVDVN
9500|gene|hbo       LSTEARPKPERDNEWRELVTREREQEVDIALVGKYDLEDAYMSVNEALKHAGIETKTDVN
427|gene|hut        LTDEALSADERENEWRELVTQDTTGSINVALVGKYGLEDAYLSIHEALKHAGLETNVEVE
1968|gene|nph       LDERALPPEERANEWRDIVTQETTDEVDIALVGKYAMEDAYLSIYESLKHAGFETNTDVN
13471|gene|hma      IASEALPEDERENRWRDLVTQNTEGEVEVALVGKYDLEDAYMSVHEALKHAGLEKNVDVN
694|gene|hhi        IATEALPEDERENRWRDLVTQNTEGEVDIALVGKYDLEDAYMSVHEALKHAGLEKNVDVN
                    :   * .  :* . **::** :   .:::****** :****:*: *:****.:   .:* 

1830|gene|nrc1      VLWVDSEKMHDHHERRIADADGIVVAGGFGSRGTAGKIDAIQHAREHDVPFLGLCLGFQL
3195|gene|hwa       VQWVDSDEMLDHHEDRLREADGVVVPGGFGSRGIAGKLKAIEYCREHNVPFLGLCLGFQM
2594|gene|hla       VLWVDADETTDRHEERLASADAVVVPGGFGSRGTDGKIEAIRYARENDVPFLGLCLGFQM
2624|gene|hvo       ILWVDSDEMLDKHEERLKDADGVVVPGGFGSRGTGGKIEAIRYARENDVPFLGLCLGFQM
9500|gene|hbo       ILWVDSDEMLDKHENRLKEADGVVVPGGFGTRGTAGKIEAIRYCRENDVPFLGLCLGFQM
427|gene|hut        TTWVHSEDLADGHDGQLDDVDAVVVPGGFGSRGTEGKIEATRYARENDVPFLGLCLGFQM
1968|gene|nph       VLWVDADEMDDAHADRLSRADGIIVPGGFGSRGTEGKIEAITYARENDVPFLGLCLGFQM
13471|gene|hma      VRWVNSEKMNDHHADRMREADAIVVPGGFGARGTEGKIEAIRYARENDIPFLGLCLGFQM
694|gene|hhi        VQWVNSEKMNDHHADRMREADAIVVPGGFGARGTEGKIEAIRYARENDIPFLGLCLGFQM
                      ** ::.  * *  .:  .*.::*.****:**  **:.*  :.**:::**********:

1830|gene|nrc1      AVVEYARNVLGMTGAHSAEIDEDTEYPVIDLLPEQYDLEDLGGTMRLGAHETAIEPGTLA
3195|gene|hwa       AVVEHAQNVLGFADAHSAELQPETPHPVIDILPEQYDVETMGGTMRLGAHETNIDPNTLA
2594|gene|hla       AVVEHARNVLGLEGAHSAEIDPDTPHPVIDLLPDQYETEDMGGTMRLGAHKTDIEPGTLA
2624|gene|hvo       AVVEQARNVLGHEDAHSAELDPETPYPVIDLLPEQYEVDEMGGTMRLGAHDTDIDAGTLA
9500|gene|hbo       AVVEHARNVLGHEDAHSAEIDSDTSDPVIDLLPEQYETEDMGGTMRLGAHETDITEDSLA
427|gene|hut        AVVEYARNVLDLEGAHSAEMEPDTPHPVIDILPEQEGVEDMGGTMRLGAQDTDIEPGTLA
1968|gene|nph       AVVEYARNVCGLDGAHSAEIDDETDHPVIDILPEQYEVEDMGGTMRLGAHETDIEAGTLA
13471|gene|hma      AVVEYARNVLDLDDAHSAELEEDTPHPVIDILPEQYEIEDMGGTMRLGAHETEINANTLA
694|gene|hhi        AVVEYARNVLDLDDAHSAELDEDTPHPVIDILPEQYEIEDMGGTMRLGAHETEIDANTLA
                    **** *.** .  .*****:: :*  ****:**:*   : :********:.* *  .:**

1830|gene|nrc1      HDLYGATSCTERHRHRYEVNPEYIDDLTADGLTFSGEAGNRMEIVEH--DDHPFFFGTQF
3195|gene|hwa       AAVYNGTVCTERHRHRYEVNPEYIDKLEAGALSFSGQANNRMEILER--SDHPFFLGTQF
2594|gene|hla       ARVYDADSCTERHRHRYEVNPEYIDRLEAGGLTFSGRADNRMEILER--ADHPFFLGTQA
2624|gene|hvo       EAVYGDTSCTERHRHRYEVNPELIDELESEGLRFSGRAENRMEILEL--TDHPFFFGTQF
9500|gene|hbo       AHVYGDTVCTERHRHRYEVAPDYIDDLEDGALTFSGRAGNRMEILER--TDHPYFLGTQF
427|gene|hut        HDLYDDTTCRERHRHRYEVNPEYIDDIEAAGMTFSGVSNRRMEILELDPDSHPYFVGTQF
1968|gene|nph       HELYADEQCTERHRHRYEVNPEYIETLESAGLVFSGQDQNRMEILEL--PDHPFFFGTQF
13471|gene|hma      ATLYGGESCTERHRHRYEVNPEYIDDLEAAGLKFSGRAGNRMEILELGPEDHPYFIGTQF
694|gene|hhi        ATLYGGESCTERHRHRYEVNPEYIDDLEAAGLKFSGYAENRMEILELAPEDHPYFIGTQF
                      :*    * ********* *: *: :   .: ***   .****:*    .**:*.*** 

1830|gene|nrc1      HPEYRSRPTRASPPFVGLLDAVLERADVAPAGSDADVEVTN
3195|gene|hwa       HPEFRSRPDRASPPFVSFLKSVDSTLDARSLNVSTSEEVQI
2594|gene|hla       HPEFRSRPDRASPPFVALVEAALGSTDTTE----RNADVRL
2624|gene|hvo       HPEFRSRPDRASPPFLGFLRAVLGELDAREL---GNEEVTA
9500|gene|hbo       HPEFRSRPDRASPPFVGFVKAVLGELDAREI--VADAEVQA
427|gene|hut        HPEFRSRPTRASPPFVGLVEAVLNSSESDE-----PQEVEH
1968|gene|nph       HPEFRSRPGRASPPFVGLVETILETTDTDT------EEVTA
13471|gene|hma      HPEFRSRPTRASPPFVGLLEAVLGDDPHTA----TTEEVSH
694|gene|hhi        HPEFRSRPTRASPPFVGLLEAVLGDDPHTV----TTEEVSH
                    ***:**** ******:.:: :                :*