HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0176COG0323KOG1979 KOG1978arCOG01166DNA mismatch repair enzyme (predicted ATPase)DNA mismatch repair protein

HOG Organism Gene ID Name Annotation
cHOG0176 nrc1 VNG0159 mutL DNA mismatch repair protein
cHOG0176 hmu HMUK0376 Hmuk_0376 DNA mismatch repair protein MutL
cHOG0176 hma RRNAC2550 mutL DNA mismatch repair protein mutL
cHOG0176 hwa HQ1456A mutL DNA mismatch repair protein MutL
cHOG0176 hla HLAC0629 Hlac_629 DNA mismatch repair protein MutL
cHOG0176 hbo HBOR26600 Hbor_26600 DNA mismatch repair protein MutL
cHOG0176 hut HUTA0007 Huta_0007 DNA mismatch repair protein MutL
cHOG0176 hvo HVO_0551 HVO_0551 mutL-2 DNA mismatch repair protein mutL
cHOG0176 nph NP0536A mutL DNA mismatch repair protein MutL
cHOG0176 hhi 2976 mutL DNA mismatch repair protein MutL
MUSCLE (3.6) multiple sequence alignment


1456|gene|hwa       -------------------------MSSNENAITALDTETVRQIAAGEVVERPASVVKEL
536|gene|nph        ----------------------------MAPEIRELDAETRDRIAAGEVVERPASVVKEL
159|gene|nrc1       ----------------------------MTDRIRALDDATVARIAAGEVVERPASVVKEL
629|gene|hla        ---------------------------MEPPNIERLDERTVQRIAAGEVVERPASVVKEL
26600|gene|hbo      ------------------------MTDDDRPTIRALDDQTINRIAAGEVVERPASVVKEL
7|gene|hut          -----------------------------MDEIRELDQTTIERIAAGEVVERPASVVKEL
12550|gene|hma      MSWLIHAGEGRQYQVAPPVSWSQSYAEARMTDIQRLDDQTVERIAAGEVVERPASVVKEL
2976|gene|hhi       -----------------------------MTDIQRLDDRTVERIAAGEVVERPASVVKEL
                                                    *  **  *  .*****************

1456|gene|hwa       IENSLDADATRISVAVESGGADGIRIRDDGIGMDEDAVQRAIKEHTTSKIDDINDLASGV
536|gene|nph        VENALDADASRVDVTVEAGGKDRIVVADDGVGMSETDARAAVKEHTTSKLRDVSDLD-TI
159|gene|nrc1       VENSLDAGAASVDVSVDAGGTDRIVVADDGRGMTGDDLRMAVRQHTTSKLDDASGLD-GV
629|gene|hla        IENSLDAGATRVAVSVEAGGTEGIRIRDDGVGIPADQLEAAVAEHATSKIGKIEDLDHGV
26600|gene|hbo      VENSLDADANRISVAVDSGGTEGVRVRDDGVGMDREDLQMAVEEHTTSKISDINDLESGV
7|gene|hut          LENSLDADASRVRVAVEAGGTESIRVSDDGVGMTEGDARAAVREHTTSKIRDISDLESGV
12550|gene|hma      VENAIDADASRVDVVVEAGGTDGIRVTDDGIGMDREAVKTAVEEHTTSKIRDIADLEGGV
2976|gene|hhi       VENAIDADATRVEVVVEAGGTDGIRVTDDGVGMDREAVETAVEKHTTSKIRDIADLEGGV
                    :**::**.*  : * *::** : : : *** *:       *: :*:***: .  .*   :

1456|gene|hwa       GTLGFRGEALYTISAVSKMTIRTKPRDG-----------NRGTELHIEGGTVVDVEAAGC
536|gene|nph        GTLGFRGEALHAIGSVARLRLRTKPRDG-----------TRGTELVVEGGDVVDCGPVGC
159|gene|nrc1       GTLGFRGEALYTIGSVAELTVTTRPRNA----------GDTGARITVDHGDAGSVAPAGH
629|gene|hla        GTLGFRGEALYTVGAVSRLTVRSRPPGA-----------DAGSEITVEGGDVGDVRPAGC
26600|gene|hbo      GTLGFRGEALHTISAVSRLTVRSKPRGGDTGRGSDAPGNDAGTELRVEGGEVTDVRPAGC
7|gene|hut          GTLGFRGEALHAISAVSRMTITTRPRGG-----------DRGTRLRVEGGEVTTVEAAGC
12550|gene|hma      GTLGFRGEALHAIGAVSRLTIRTRPRGG-----------DVGTELVLEGGDVTSVSPAGC
2976|gene|hhi       GTLGFRGEALHAIGAVSRLTIRTRPRGG-----------DVGTELVLEGGDVTSVSPAGC
                    **********:::.:*: : : :.* ..             *: : :: * .    ..* 

1456|gene|hwa       PEGTVVEIRDLFFNTPARRKFLKTTATEFDHINTVVTHYALANPDVAITLEHNDREVFAT
536|gene|nph        PEGTTVEVTALFENVPARRKYLKTDTTEFDHVQQVVAGYALAAPDVAVRLDHDGRETFAT
159|gene|nrc1       PAGTTVEVTDLFGETPARRKYLKRAATEFGHVNRAVTRYALANPDVAVSLTHDGREVFAT
629|gene|hla        PEGTTVEVDGLFYNTPARKKFLKRTATEFDRVNAVVTGYALANPGVAVSLEHDGRETFAT
26600|gene|hbo      PEGTVVEVEDLFYNTPARKKFLKTTATEFDHVNTVVTQYALANPEVAISLEHDDREVFAT
7|gene|hut          PEGTTVEIADLFYNVPARRKYLSRDATEFDHVNTVVRNYALANPAVAVALEHDGRETFAT
12550|gene|hma      PEGTTMAVEDLFYNVPARRKYLKQESTEFAHVNTVVASYALANPDVAVSLTHGDRETFST
2976|gene|hhi       PEGTTMAVEDLFYNVPARRKYLKQESTEFAHVNTVVASYALANPDVAVSLTHGDRETFST
                    * **.: :  ** :.***.*:*.  :*** .:: .*  **** * **: * *..**.*:*

1456|gene|hwa       TGRGNLESAVLSVYGREVAESMISI-----------TTGDIESDRITAIEGLISHPEKTR
536|gene|nph        PGDGDRQSAVLEVYGREVAASMVSV------------EQSWDDGPVAGVAGLVSHPETNR
159|gene|nrc1       TGTGDVQDAALAVYGREVAQSLRTV------------DADPAADSVERVHGYVSDPEVTR
629|gene|hla        EGNGDLRSAVLAVYGREVADAMVDM--------EWEPGNSDTDSPVHSVTGLVSHPETTR
26600|gene|hbo      EGRGSLESTVLSVYGREVAESMTRV------------EHEPDDGPVASVTGLVSHPETTR
7|gene|hut          TGGDSLRETVMAVYGREVAESMIDV-----------DARELPAGPLDAIDGLVSHPETNR
12550|gene|hma      TGQGDLRETVMSVYGREVAESMISVGAGSEATGSGDEMDSFPDGPLDGVHGLVSHPETNR
2976|gene|hhi       TGQGDLRETVMSVYGREVAESMISVGAGSEANADGDESDSFPDGPLDGVHGLVSHPETNR
                     * ..  .:.: ******* ::  :              .   . :  : * :* ** .*

1456|gene|hwa       STRQYLSTFINGRYVEARALREAIINAYGDQLAANRYPFALLFLDIDPGSIDVNVHPRKM
536|gene|nph        AGRDYMTTLVNGRYVTASAVREAIVEAYGRQLAADRYPFAVIDIDLPPGGVDVNVHPRKL
159|gene|nrc1       STREYLATFVNGRAVTDAVLREAVLDGYGDQLAPDRYPFAVLFVDCE--GVDANVHPRKL
629|gene|hla        SSREYLATYVNGRYVTAGALRDAVLDAYGGQLAPDRYPFAVLFVEVPPGDVDVNVHPRKL
26600|gene|hbo      SARDYLSTFVNDRYVTARVLREAVLDAYGGQLATDRYPFAVLFVDVPPNTVDVNVHPRKM
7|gene|hut          ADREYVATFVNGRYVRSSAARNAIVEAYGNQLSPDRYPFAVLDLSLPAGTVDVNVHPRKM
12550|gene|hma      AGREYLSTYVNGRYVRAGTVRDAVIDAYGTQIAPDRYPFAVLFLDVPAGDVDVNVHPRKM
2976|gene|hhi       AGREYLSTYVNGRYVRAGTVRDAVVDAYGTQIAPDRYPFAVLFLDVPAGDVDVNVHPRKM
                    : *:*::* :*.* *   . *:*:::.** *::.:*****:: :.     :*.******:

1456|gene|hwa       EVRFDNETGVRDAVTNAIREALLSAGLIRSRAPRGQSAPAETEITQS-SPDVTTKSANDD
536|gene|nph        EVLFSDEKTVRERVENAVESALLDAGLLRSRAPRGQSAPEQTEIPADEEPPRTESGHRR-
159|gene|nrc1       EVRFEDEAGVKAAVEAGVRDALLDAGLVRAGAPRGASKPGDAEISPEHSPTDRDAGAAGG
629|gene|hla        EVRFDEEPAVRAAVEEAVEAALLDHGLIRSTAPRGQSAPDQTEINPE-GPETEAIGGAGT
26600|gene|hbo      EVRFDDESGVKSAVESAVESALLEQGLIRSSAPRGRSAPDEVEPAPE-SPTAEARGGKGH
7|gene|hut          EVRFADEAGLREQVRAAVEETLLENGLIRSGAPRGQSAPEQTEIDPT-ATTPDSGVSTSE
12550|gene|hma      EVRFADDEGVREQVRTAVEDALLREGLLRSTAPRGRSAPEQTEITPE-SDGATDSGGERA
2976|gene|hhi       EVRFADDEGVREQVRTAVEDALLREGLLRSTAPRGRSAPEQTEITPE-SNGTSDSERERS
                    ** * ::  :.  *  .:  :**  **:*: **** * * :.*                 

1456|gene|hwa       TN-VDNNEITETSVHTSAEKSEPDNNIKKT--------------TQAQSDAEDERTDITE
536|gene|nph        -------------------RPAVGSSSTSG-----------------------RAADSTE
159|gene|nrc1       GDAAGQSDGNG-------QRTAASGATSES------------------------PASAFE
629|gene|hla        DHERAALEDRESGDRAGESRDGNDDSAAGS------------------------AADASE
26600|gene|hbo      SPQPSQSDGRS--------RSGSSPTVSDSPRSATSGTESARSTPNAESAHSDRTGDAAA
7|gene|hut          SS-------RE--------ESESEPSIAKG------------------------TNDASR
12550|gene|hma      AP-------NG--------RDAIDDATTSG------------------------QTDTTA
2976|gene|hhi       SP-------DG--------RDTGDEAATPG------------------------RTDTTA
                                                                            .   

1456|gene|hwa       SDVGDKNQQGETSIDSSRDTTVEGADVDS---------ETARHVDPRSDAAWTVDNNRRS
536|gene|nph        QSNAADDVRSDPPAASGGGTE-----------------PDVTASSDGT-----------T
159|gene|nrc1       TGGGDEAADSAAS-------------------------TDGTRERPGS------------
629|gene|hla        LDPTDDDAWAVGDVSSDDTADPGGPPADRTGESAGPTAPDGSNSSAGSASDRPSPRSWQS
26600|gene|hbo      PRPTGDATTETPDESAENTGETSSEAADT---------SQGVTSDEAWSVSAGRTRSRPS
7|gene|hut          PSGSDQSAEPTPA----------ASKSDA---------SQRTESEHGF-----------T
12550|gene|hma      TENSAEAPAQEPD----------TAPTAR---------PDGTQTETGN-----------C
2976|gene|hhi       T-GSADATAQEPD----------TEPTDR---------PDSTQTETAG-----------S
                         .                                                      

1456|gene|hwa       EDADIDSSINQQSSQSSETIGASTPNA---TADTTVQSQSKSTEDVDNGHKDAGEECDAV
536|gene|nph        ESDATGPANASNDGPAPSPTSSPDESPGHAAADAAPPT-AGESPAVARDDADSEST----
159|gene|nrc1       --------------GTESRTGRFD-AP---AENARLPT-GAGGPEADDQDTTSERD----
629|gene|hla        EPDDAEDGTEEGDTGAVAGVEADTEGD---AGEAGGLD-RFGGSATDDNEDSGATDTSPD
26600|gene|hbo      RAPETPSSKDKSDEDTDMQTSRTGEAP---EAKAETRT-ANPTQASLSGVSDEDHDSAEV
7|gene|hut          KAPNQAET----DTEPERRTGRTQHGT---EPDSAAPP-AETGSPASAGHGEGTSQ----
12550|gene|hma      ESSDTAPSIQSADTKPSSETGRTD-GT---SGESGT---GQTGGSVSGGDSDSERP----
2976|gene|hhi       QSSGTAQSIQSADTKRPSATDPTDDA----SGESGV---RDPEGSVSSGNSNGERR----
                                                    .:                          

1456|gene|hwa       VSGNNHNKNQSKKADPNDSVNEQSVQHDLGGDVATLEP-TVESLPSLRILGQIDETYIIA
536|gene|nph        -----ADAAASASDGTD-RFRAATTQRTLDGETTTGTPETFDRLPSMTVFGQFDDTYLVA
159|gene|nrc1       ------------------------------------------SLPDLRVLGQLHDTYVVA
629|gene|hla        PTADASGGRREPTAQPR---STATAQRTLDGEPTSAER-TYDSLPPLRVLGQLHETYVIA
26600|gene|hbo      TAGRSETASTAETTAPR-RLGAPTVQRDLGGDEATLSP-EFDTLPSMRVLGQLLDTYIVA
7|gene|hut          --GSGEPERRGAGDAET-AVVDAGSQTRLESGEEPLEQ-TFDSLPSMRVLGQFQETYVVA
12550|gene|hma      --GASATGQTAAERGER-KFTGGQEQARLGDDPEA----THESLPSMRILGQLADTYVVA
2976|gene|hhi       --DASAAGRTATESEGR-KFTGGQEQARLGDDPEA----THESLPSMRILGQLADTYVVA
                                                               ** : ::**: :**::*

1456|gene|hwa       ESDDGLVLIDQHAADERINYEQLQATLAETVTTQALAEPVKIELTAGESAQVEEYADALE
536|gene|nph        EADDGLVLIDQHAADERINYERLKAAVDGDLTTQALAEPVSVSLTAREAALVEEYGEALS
159|gene|nrc1       EAGDGLVLVDQHAADERVHYERLQARVDG--ASQALVAPAELELTAGEAAVFEAALGGLR
629|gene|hla        EAPDGLVLIDQHAADERVNYERLQTAFADGADAQALAEPVRIELTAREAALFEEFVDDLA
26600|gene|hbo      ETADGMVLIDQHAADERVNYERLQRELAGDVTTQALADPVEMELTAREAALFEEYQDALA
7|gene|hut          ETDTGLVLIDQHAADERINYERLRDAFAGETTTQALAQPVEIDLTARESSLFEDFQAALA
12550|gene|hma      ETDDGLVLVDQHAADERVNYERLKAKFEGETTTQALANPVELGLTAREAEVFDRRSDALA
2976|gene|hhi       ETDDGLVLVDQHAADERVNYERLKAKFEGETTTQALANPVELELTAREAEVFDRRSDALA
                    *:  *:**:********::**.*.  .     :***. *. : *** *:  .:     * 

1456|gene|hwa       RVGFRVTDGDGDNIVVTAVPAAFASALD---PALVRDVLAETAESLNSHDRSETIKTLTD
536|gene|nph        RLGFRVRTDDDRTLTVTTAPALLVEAAGDAMPELARDLLGEFT-G-GDPDG--TVAAVVD
159|gene|nrc1       ELGFDAELAG-RTARVTAVPAVLADALD---AELARDVLSSFL----ADADGTPVADAAD
629|gene|hla        GVGFRAERADEREVVVESVPAVFDAALD---PELLRDVLSALV-G-DATAGDEPVTDVVD
26600|gene|hbo      QTGFHAGRTGERTVEVRSVPAVFAEALR---PELLRDALTAFV-SEGEDGGRETVDAVAD
7|gene|hut          RLGFSAERVDDRTVAVTTVPSLVAETAD---PELLRDVLSSFV-D-SDSDPGATVEAAAE
12550|gene|hma      SLGFHTARTGERSVEVRTLPGVIADAAG---PDIVRDVLGAFV-A-GDDEAAATVEAAAD
2976|gene|hhi       SLGFHTARTGERSIEVRTLPGVIADAAG---PDIVRDVLGAFV-A-GDDEAAATVEAAAD
                      ** .   .     * : *. .  :     . : ** *              .:   .:

1456|gene|hwa       DILADLACYPSLTGNTALTEGSTVNLLEQLDTCENPYACPHGRPVLIEFDRTELDARFER
536|gene|nph        DLLGDLACHPSIKGNTSLREGTVEGLLSALDDCENPYACPHGRPTVLELPREEIETRFER
159|gene|nrc1       AVLADLACSPAIKGNTSLAEGSVVALLDALDACENPYACPHGRPTIVEVDGDELAARFER
629|gene|hla        ELLADLACYPSVTGNTSLTEGSVVDLLDRLDDCENPYACPHGRPVVIRLNREEIGSRFER
26600|gene|hbo      ELLADLACYPSVTGNTSLTEGSVLDLLSALDDCENPYACPHGRPVVIEFDRDEIEDRFER
7|gene|hut          AVLADLACYPSITGNTSLTEGSIVDLLERLEACENPYACPHGRPVVVEIDADELAERFER
12550|gene|hma      ELLGDLACYPSVTGNTSLTEGSVRELLAALDDCENPYACPHGRPTVIHIDRQELEDRFER
2976|gene|hhi       ELLGDLACYPSVTGNTSLTEGSVRELLAALDDCENPYACPHGRPTVIHIDRQELEDRFER
                     :*.**** *::.***:* **:   **  *: ************.:: .   *:  ****

1456|gene|hwa       DYPGHKDRRLE----
536|gene|nph        DYPGHGDRRE-----
159|gene|nrc1       DYPGHAGRRREDAGN
629|gene|hla        DYPGHAGRRTE----
26600|gene|hbo      DYPGHGGRRSE----
7|gene|hut          DYPGHTTRRLD----
12550|gene|hma      DYPGHGGRRR-----
2976|gene|hhi       DYPGHGGRRR-----
                    *****  **