HOG Organism Gene ID Name Annotation
aHOG1759 hbo HBOR15240 Hbor_15240 transcriptional regulator, AsnC family
aHOG1759 hbo HBOR30310 Hbor_30310 transcriptional regulator, AsnC family
aHOG1759 hla HLAC1471 Hlac_1471 transcriptional regulator, AsnC family
aHOG1759 nph NP6200 transcription regulator
aHOG1759 nrc1 VNG1351 aclR5 transcription regulator (trh6)
MUSCLE (3.6) multiple sequence alignment


6200|gene|nph       MTGELDERDFRILCAIAEHETFSSEDLHEETGIPKSTVHYRIQNMKDEGVIKNELFEFDR
30310|gene|hbo      ----MDEKDVQILKSMEDLETTSTEAVSDATGIPISTIHYRLNKLRETGVIKNDRLDIDL
1351|gene|nrc1      ----MDDRDITILKAIADLGTGSPEALQEETGIPVSTIHYRLNNLRDDGVITNDLYDINP
15240|gene|hbo      ----MDERDIRLLKAISDLETGSPEQLHEETGIPVSTIHYRLNNLREAGVIKNDLYDIDL
1471|gene|hla       ----MDERDVRLLKAISDLGTGSPERLHEETGIPVSTIHYRLNNLREDGVIENDLYDLDH
                        :*:.*. :* :: :  * *.* : : **** **:***::::.: *** *:  ::: 

6200|gene|nph       EKIGIEITLISEVWAEFGEGYHDTVGEKLSEIEGVNQVYFTMGDTDFVAIARLTSRDMVE
30310|gene|hbo      DKLGLGVTILVEVFTKDDRNHTE-SGRIISEVEGVTKVFFTMGSTDFIALARLPDSDSVE
1351|gene|nrc1      DSIGLDVTVVLEVLTSYDGGYED-VADEISAVEGVTQTFFTMGETDFVVVARLPGSDDVE
15240|gene|hbo      EKVGLGVTVVVEILTDYSGSHHD-FKEKILDVEGVTQAYFTMGETDFIVVAHLSGREMVE
1471|gene|hla       EALGLGVTVIVEVLADYEGPYEE-FAEELLAVEGVTEAFFTMGETDFVVLARLSSSDTVE
                    : :*: :*:: *: :.    : :     :  :***.:.:****.***:.:*.*.. : **

6200|gene|nph       QLVEDYESIDEIQRTSSKFAISTIKEDISISALGDYSVETLLDS---D
30310|gene|hbo      RLISDFEELDAVARTDSTFVIDRELD--SHYALQQYAEETLVEELIEE
1351|gene|nrc1      RLISDFEALDPVDRTNSTFVIDRHKD--AQRALESYSLDSLVTALADE
15240|gene|hbo      RLITDFETIDEVDRTNSTFVISSLRD--SARVLQNYELETLLDELLDD
1471|gene|hla       RLISDFEAIPEVERTNSTFTIATLRD--ESRAPATYDLDTLIEELTD-
                    .*: *:* :  : **.*.*.*    :     .   *  ::*: