HOG Organism Gene ID Name Annotation
aHOG1756 hbo HBOR25690 Hbor_25690 sulfite oxidase-like oxidoreductase( EC:1.8.3.1 )
aHOG1756 hmu HMUK1764 Hmuk_1764 oxidoreductase molybdopterin binding
aHOG1756 hut HUTA1532 Huta_1532 oxidoreductase molybdopterin binding
aHOG1756 hut HUTA2513 Huta_2513 oxidoreductase molybdopterin binding
aHOG1756 nph NP2044 nitrate reductase / sulfite dehydrogenase (nitrate/ sulfite:cytochrome C oxidoreductase protein)
aHOG1756 hma Hma_11375 soxA2 putative sulfite oxidase
aHOG1756 hma Hma_11624 soxA3 sulfite oxidase
MUSCLE (3.6) multiple sequence alignment


2513|gene|hut       ---------MPQNTTGEFAWTA--GAIAWVLAMVAARPLVGSDPLLVIS---QTVIETAP
11624|gene|hma      ---------MTDDLLDSPGGRLLVSVAAAIAGLAGSYAVTGYAPAFIASPIERTLARSMP
1532|gene|hut       -----------------MDKRVQVFALAGISGVAGSYALAGYTRQFIVAPIDAVVVRSTP
25690|gene|hbo      ---------MTSNRLQRVGPTSFVAFLAGVAAVAGSYATAGFTPAFVVAPVAAFLTRTVP
2044|gene|nph       MSDSDSARSDNGSAIGRYGMAAIAVVAAGVSTVATSFAVYATGREFLVSSLNRHLLEYLP
11375|gene|hma      -------MSETSEVFQGRSRRAITVFTSGVSVVGTSFALYGTSREFVIIAASRTALDILP
                                               : :  :  : .  .    ::            *

2513|gene|hut       GSLATWAIETFG--------VAAQTVLVAGVGVGIVIAAGIVGAI--GDRVEVSRRQRSR
11624|gene|hma      GIVVSTAISTLG------SLGQQLNLLLAIALAGLFIALAARAAILTGQLTNNRALPVV-
1532|gene|hut       GPIVAWMITNVG------DAGHLLHIALSMAIAGVLLGTTAVLGQFVGAKLDRWFLAPG-
25690|gene|hbo      DAVLRFAIVTLGTFAGIDHFGQLLNLALATGLTTALLAGVSFLALVAGRRLDARLAPVG-
2044|gene|nph       GWFVSGVIQRFG------NLALELSMVFSGALLAVVFGIVAVGGYRLGDRLSPTLPPVAG
11375|gene|hma      SSVVASIIWNFG------DLSFSLALLVFGIALAGVTGAVSYAGFRTGERLVEGAPNIGG
                    . .    *  .*             : .       . .     .   *            

2513|gene|hut       --VLRSTAVTATIATAGGFYLAAGGVSTRWLLASGIALTGPGMVWWIYTG---TRASIGR
11624|gene|hma      --GTAVVTWAVSVVLTGEVVLAAGPA------VPAAAVVGLAQLLDGFGG-SVSPISSKR
1532|gene|hut       --VAGVLAWALTVAITTEPVLSLGAA------LPVALFTVIGA-----GSLSTADHDPSR
25690|gene|hbo      --LVGASMWVVTVVLTGQLMLSLGAA------VGGAVVVLVAELAAVMGEPSAATDSSVR
2044|gene|nph       FVVATALVFVVSYSVVGSAMAVVVPA------LVG----GVVVTYFETRSPTEIATDSER
11375|gene|hma      MVLSLLAVWVFVAATVWAPLPAIVPA------AAGTIGTGLVIARSTDNSNGQPATPDDR
                             .     .         .                                 *

2513|gene|hut       RRALGRIGGGISAVVAGGAVARLIGQPVPKGGPQPGEPLELEEKTETGTTTPTTRGARDE
11624|gene|hma      RRALSTVGAAIGAATVGYA----AGNQ------------RSVAATGDDAPVLNAPGADLD
1532|gene|hut       RRALGSIQSAIGFVVV-------AGGA------------GWIKTNSDTETADEEPASDPP
25690|gene|hbo      RRVLGGVASAFGVGILSYLFGRSASGP------------AAVTSSVDGSGTPGGPDGSGP
2044|gene|nph       RSVLRAVSAVAAFNVV-------AHGI------------GLVRRSQTQRAEQELQERALR
11375|gene|hma      RAFVKTLAGLGAYNVVAHAVGFVQGSG----------------SQTEDLSTSSSEREDES
                    *  :  : .  .                                                

2513|gene|hut       AAIESRRSSEGVVVSL-SNDETDFAFDF--AGMPPQSQSAADHFVVDKNISAPKVNTENW
11624|gene|hma      DVDEK------------LAVAAESSLGF--GDIDPLVSE--NFYEVDINSIDPQISAADW
1532|gene|hut       SPVTRR-----------LEEANTQSLDLAADNVPGLVSSIGEFYNVDIAEFDPEIADDDW
25690|gene|hbo      SSNDSQSVGDSTVTQEYLAEAERRTLDV--DGLEGLVSD--DFYQVDINNIDPNLRASDW
2044|gene|nph       LEAEHM-----------ISDARQKELDV--EGVQPLVTDIEDFYKVDINPSPPAVDPDSW
11375|gene|hma      NPVEQR-----------LATAADRSFDV--EGMTGLVDTTDSFFTVDINPRPPTVETDSW
                                             :..   .:        ..: **     * :   .*

2513|gene|hut       ALAIRGAVDDEIDFAYETLRKHPDRRELTVTTLCISNEVGGDLIGTTDWIGIPVRRLLAE
11624|gene|hma      SLSITGAVEEEVTLDYEDIIEMDAENRF-VTLRCVGESLNGYKTDNALWTGVPVDSLLEE
1532|gene|hut       SMGLTGEVETEFSVTFEELTDRPTEHRY-VTLRCVGESLNGRKLDTAVWTGTPIKPLLEE
25690|gene|hbo      TLSVTGSVEQEATYTYDELTAMGDEQRF-VTLRCVSDKINGTLMDTDLWTGVPISRILDE
2044|gene|nph       ALSITGAVEEPVDLDYAEIQRFPVEHQY-KAIRCLSDDIEDDKLDTAVWTGCSMDAVLDA
11375|gene|hma      TLSVTGNVETEREFTYEDLRQRETITRF-KTLRCLGDPVDGEQIGTALWTGCSLMDLLSE
                    ::.: * *:      :  :           :  *:.: : .   ..  * * .:  :*  

2513|gene|hut       ANVTDDAVDVVTHARDGYSEAIPWSVVRDRDDIILAVGMDGKALPRAHGFPVRLLIPGRY
11624|gene|hma      AGVQSGCECVMLRAEDDYYEEFP---IDALRGGMLAYGMNGKILPRGHGYPVRALVPGHW
1532|gene|hut       ADPEGDCDCAMLRAEDGYFVQFP---VEALEDAFLAWEMNGRPLPKSHGHPVRVLVPGHW
25690|gene|hbo      VNPQG--AFVMLRAADDYFEEFP---VEALEDGFLAYGKRGGPLPRAHGHPVRALIPGHW
2044|gene|nph       VDLQG--SHVMLYGADDYFYSMS---VEDFRSCLLAYGMNGLELPQAHGYPVRLLVPDRW
11375|gene|hma      AGANG--SHVVFRAADDYYYSMP---MSMLSDAMLAYGMNESQLPRQHGFPVRALLPNRW
                    ..  .    .:  . *.*   :.   :    . :**       **. **.*** *:*..:

2513|gene|hut       GMKSTKWVTEIELADSDHTAYWDQRGWDEEAVVNTLSYIRAIQR-RGDRVGIGGVAYAGT
11624|gene|hma      GEVNVKWLSEIEVLDEEADGYWEKRGWQGTGPVNPVAKLHHESMLSDGRRRIGGPAYAGL
1532|gene|hut       GETNVKWLTEIELLDEAMDGYWEQRGWHGTGPVNTVAKLWDDTRLDDGRIEVAGHAYAGT
25690|gene|hbo      GEINVKWVTEMEILDGPEKGFWERRGWHGTGPVNTVAKLHTTNR-RDGQIQAAGHAYAGT
2044|gene|nph       GKLHVKWLTEIEVIDDYSGGYWEEQGWHGMGAVNAVTKIDRINR-PEGRIQICGHAYAGA
11375|gene|hma      GKLNVKWLDEIEVVDQSESGYWEERGWNGMGTVNTVVKISTSNRLSDGRVQLGGHAYAGT
                    *   .**: *:*: *    .:*: .**   . **.:  :        ..    * **** 

2513|gene|hut       RGIEGVEVSLDGGETWTDADLEAPI----------SPHAWRRWQLVVDRPDAGPLDAVVR
11624|gene|hma      RGVKRVEVSTDGGETWADATLSDQLPAASGDG--PAADAWRQWEYTYDPPSSG-HTVVVR
1532|gene|hut       RGIERVEVSTDGGASWTDATLSAPLP---------GEDVWRQWSHVY-EPTGD-HEVVVR
25690|gene|hbo      RGIERVEVSIDGGETWADATLSDRLPAGTDESGEAAEDAWRQWEHTYENPGRR-HTVVVR
2044|gene|nph       RGVDRVEVSIDGGETWTAAALSGQLD---------NPDTIRQWVYEIDDPQQDEYEVYAR
11375|gene|hma      DGIRAVLVSLDGGETWDTATLSDQLP---------DPDTWRQWKYEW-QPERSSYTVIAK
                     *:  * ** *** :*  * *.  :             . *.*      *      . ..

2513|gene|hut       ATDGEGTRQTSQTAPPHPSGSAGWHSSSVSL--
11624|gene|hma      MVDQRGEVQPETETDSYPSGASGWVSKQYS---
1532|gene|hut       AIDGEGDRQPRDQSDSFPSGATGWVSKEISA--
25690|gene|hbo      ATDSTGTLQPREEESPFPSGATGWVSKTISP--
2044|gene|nph       TIDGTDTIQTEVRTDPFPDGATGWVNRTIRRG-
11375|gene|hma      AIDGTGAEQTRVRSSPFPDGATGWSRLDLSVQL
                      *  .  *.     ..*.*::**