HOG Organism Gene ID Name Annotation
aHOG1751 hmu HMUK2087 Hmuk_2087 conserved hypothetical protein
aHOG1751 hut HUTA0187 Huta_0187 conserved hypothetical protein
aHOG1751 nph NP3996 hypothetical protein
aHOG1751 nrc1 VNG1473 vng1473 no entry
aHOG1751 hma Hma_10791 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


10791|hp|hma      MTSEQQLFD---ETPLRRFEYDDSVVFAADVGPAAD-ASVDVVDGTVIVVADG---HQYE
3996|hp|nph       MREKLRTLRNDLDGPVRQYDYEDAAVLAADFGAVDG--HVDVVDGTAIVVVDG---EQYE
187|chp|hut       MRLEQQTVG---DAAIRRFDYEDATTFVADIG-RDG--AVDVVGDTAIVITDD---DQYD
1473|hp|nrc1      MTSKTHLTES--DPLVRRYDYGDAVIVAADLGVDDDRVAVDVVQDTAIVTRDDSPTDQYE
                  *  : .      :  :*.::* *:. ..**.*   .   **** .*.**  *.    **:

10791|hp|hma      QEIPAGDA-RAFINHGVLTIELSGSEGDY
3996|hp|nph       FAVPADPA-RAVMNNGVVTIEMER-----
187|chp|hut       VSLPDGGEPTAFMNNGVLTIEVKG-----
1473|hp|nrc1      LPVPDGDSTRAFINNGVVTVEVSR-----
                    :* .    *.:*:**:*:*:.