HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0175COG0044KOG2584arCOG00689Dihydroorotase and related cyclic amidohydrolasesdihydroorotase

HOG Organism Gene ID Name Annotation
cHOG0175 nrc1 VNG2533 pyrC dihydroorotase
cHOG0175 hmu HMUK0212 Hmuk_0212 dihydroorotase, multifunctional complex type( EC:3.5.2.3 )
cHOG0175 hma RRNAC2232 pyrC dihydroorotase
cHOG0175 hwa HQ1061A pyrC dihydroorotase
cHOG0175 hla HLAC2077 Hlac_2077 dihydroorotase, multifunctional complex type
cHOG0175 hbo HBOR03960 Hbor_03960 dihydroorotase, multifunctional complex type( EC:3.5.2.3 )
cHOG0175 hut HUTA0970 Huta_0970 dihydroorotase, multifunctional complex type
cHOG0175 hvo HVO_1816 HVO_1816 pyrC Dihydroorotase
cHOG0175 nph NP1706A pyrC dihydroorotase
cHOG0175 hhi 2704 pyrC1 dihydroorotase
cHOG0175 hhi 5304 ureX urease subunit
cHOG0175 hhi 5296 pyrC2 dihydroorotase
MUSCLE (3.6) multiple sequence alignment


5304|gene|hhi       MARARPLSHTVETTERAKRPFRESADMTELSAASIAFRDARVLDGSGRPPFTASVRVADG
5296|gene|hhi       -------------------------MTDIHIKDAQVVTASGIQHG--------EIAISDG
1061|gene|hwa       --------------------------------MPSVFKSARLPDGRIR-----DVRVTDE
2077|gene|hla       ----------------------------------MLITGAELADGRVR-----DVRIRDG
2533|gene|nrc1      ---------------------------------MRVIRDAVLADGRVR-----DIRLDGE
1816|gene|hvo       ----------------------------------MRIENATLADGRAV-----DVRVEDG
3960|gene|hbo       -----------------MKNRGAYPLRVERTDMSLLITGATLADGRVR-----DVRVEGE
1706|gene|nph       ----------------------------------MLFSNATLADGRVR-----DVRVDGE
970|gene|hut        ----------------------------------MLIRNATLPDGRRR-----DVRVDGE
12232|gene|hma      ----------------------------------MLIRNATLPDGRQR-----DVRVRGE
2704|gene|hhi       ----------------------------------MLIRNATLPDGHQR-----DVRVRGE
                                                        .  : :  *        .: : . 

5304|gene|hhi       RIDAIS-----EAPLAADRVVDLDGS-YLAPGFIDMHAHSELRLFENPG---AREKLTQG
5296|gene|hhi       TIDAAGPASSVPTPSDPDTVIDADGM-VALPGAIDVHTH-----MHDDELFPDGIDFASQ
1061|gene|hwa       TITAVS---DSISPTSDETVFDARGM-LLFPGAIDVHVH-----FREPG-GEHKETWKTG
2077|gene|hla       TIDAVEPTNAGLDADTGERVVDARGR-HLLPGAVDVHVH-----FREPG-ASHKETWTSG
2533|gene|nrc1      RIDAVG------TALDGELFVDANADYRVLPGMIDAHVH-----FRQPG-FEHKETWASG
1816|gene|hvo       TVEAVG----DLDSVDAEETVDAEEN-LLLPGAIDVHVH-----FREPG-FEHKETWETG
3960|gene|hbo       TITAIE---ESLDPREDERVVNATGK-MLFPGAIDAHVH-----FREPG-FSHKETWETG
1706|gene|nph       TIAEVG---TGLEADG--EVVDAEGK-RLLPGMIDAHVH-----FRQPG-YSHKETWETG
970|gene|hut        QIGAVG---EALSGAEGEREIDATDK-RLLPGMIDAHVH-----FRQPG-YPHKETWTTG
12232|gene|hma      SIAEVG---RDLDASD-QHVIEATGK-RLFPGMIDVHVH-----FRQPG-YPHKETWESG
2704|gene|hhi       SIVEVG---RDLDASD-QHVIEATGK-RLFPGMIDAHVH-----FRQPG-YPHKETWETG
                     :                  .:        ** :* *.*     : :             

5304|gene|hhi       ITTEVLGQDGVSVAPVPPNLTDEWAERVKSLDGTLGETWPWHTVSGYLEALESAEPAVNC
5296|gene|hhi       TASAVAG--GVTTVIELPTQTPV-------------------TTP---EAMQEKAAACSA
1061|gene|hwa       SQSAAAG--GVTTVVDQPNTNPP-------------------TTTK--TAYTSK-AALAA
2077|gene|hla       SRGAAAG--GVTTVVDQPNTSPP-------------------TVDG--DAFDEK-AALAA
2533|gene|nrc1      SRSAAAG--GVTTVVDQPNTAPP-------------------TVTG--DAVDEKAAHAAA
1816|gene|hvo       ARSAAAG--GVTTVADQPNTDPT-------------------TTDG--AGFDVK-AECAA
3960|gene|hbo       SQSAAAG--GVTVVADQPNTQPP-------------------TTTG--SAFDEK-AGLAA
1706|gene|nph       SKSAAAG--GVTAVFDQPNTDPP-------------------TIDA--DGYAEK-ASLAT
970|gene|hut        SQSAAAG--GVTTVVDQPNTDPP-------------------TVDG--DAFDRK-ADLAA
12232|gene|hma      SRSAAAG--GVTAVVDQPNTDPP-------------------TIDG--ESFDQK-AEFAA
2704|gene|hhi       SRSAAAG--GVTTVVDQPNTDPP-------------------TVDG--EAFDQK-AEFAA
                        . *  **:..   *.                       *      .     .    

5304|gene|hhi       AYYAPHGNIRSMLAGFEDRPLGGEHVVAAGPVTGHRLDRPKSDHDTAPG-ELDA-IRQEL
5296|gene|hhi       LAHVDFGLVAGNVQDPDIDV---AGIVDAGTAD-------FKTFTADPYLASDASIARLM
1061|gene|hwa       DSVVDYGINGGVTPDWNPDTLFECPLFALGEVF-------LADSTGKMGIDETL-FRQAL
2077|gene|hla       DSLVDYGINGGVTADWDPESLFERPLFALGEVF-------LADSTGDMGIALDL-FEEAL
2533|gene|nrc1      DSVVDWGVNGGVTGEWDPASLFDRSLFALGEVF-------LADSTGDMGIDAAL-FRDAC
1816|gene|hvo       NACIDYGINGGVTADWDPDSLFDRPLFALGEVF-------LADSTGDMGIEADL-FAEAA
3960|gene|hbo       ASLIDFGISGGVTADWDPDSLFDRPLFALGEVF-------LADSTGDMGIDADL-FADAV
1706|gene|nph       ASLVDYGINGGVTENWSPTELLEEPIAALGEVF-------LADSTGDMGIGRER-FAEAL
970|gene|hut        ESLVDFGLNGGVSPAWDPDSLLDRPVFALGEVF-------LADSTGDMGIDERR-FRDAL
12232|gene|hma      DSVVDWGINGGVTADWIPNVLLRRRLFALGEVF-------LADSTGDMGIEADL-FADAL
2704|gene|hhi       DSVVDWGINGGVTADWIPNVLLRRRLFALGEVF-------LADSTGDMGIEADL-FADAL
                          *   .              :   * .                       :    

5304|gene|hhi       EVALEQGAFGMSKGMIYPPSSYARDDELVALAD------TLAKRDSFMISHVWNETDRVV
5296|gene|hhi       RRVGDAGG---------TVRVHCETQGLLDDAR------SAIDGDEPEVYMDSRPLEAEL
1061|gene|hwa       IRAAKTEI---------PVTIHAEDAAQFNTDIYGHESGGTGTDAAVDIWSQYRSATAEI
2077|gene|hla       AEAAARDV---------PVTVHAEDETLFDESALDGDLGGVGTAANADAWSAYRTAEAET
2533|gene|nrc1      QRAASEDV---------VVTVHAEDADRFDTAA--------KSRSDADAWSAYRTPEAEA
1816|gene|hvo       ERAGEAGV---------PVTVHAEDADLFDESAIEGDLGGVGRDADADAWSAYRTAGAEA
3960|gene|hbo       ERAADADV---------TVTVHAEDADLFDESAQKRDTGGTGEAADADVWSQYRAAEAEE
1706|gene|nph       DHATDAGV---------LVTVHAEDATRFDESA--------TERDNADAWSAYRTAAAEI
970|gene|hut        AAAAEADV---------TVTVHAEDASRFNLGA--------RDRIDADAWSAYRAARAEI
12232|gene|hma      EAATDNDV---------PVTVHAEDADYFNDDA--------KARDDADAWSAFRTAKAEE
2704|gene|hhi       EAAADTDV---------PVTVHAEDADYFNDDA--------KARDDADAWSAFRTAKAEA
                      .                  :.     .                        .      

5304|gene|hhi       ESIDRYLDICRRGGCHAHVSHLKVG-GQ------QNWGDSEAVLD-----LFDDAADRGQ
5296|gene|hhi       DAISRAGYFAEYADCPLHVVHISSGSGAREGDRFKSRANVPVTLETCPQYLAFSKGDVAE
1061|gene|hwa       KAIERAIEIATEVGADIHIAHTSTPAGV------DAATASNVTCEVTPHHLFLSRDNAAK
2077|gene|hla       AAIERALDAGAESDAQVHIAHTSTPEGI------DAVSDTDATCEVTPHHLFLSREDAGR
2533|gene|nrc1      AAVERAVEVGTEAGATIHIAHTSTPEGV------DAAAAGGATCEATPHHLFLSRDDLDD
1816|gene|hvo       VAVERAVRVGGETGAQIHIAHTSTPEGV------DAARDGGATCEATPHHLFLSRDDLDE
3960|gene|hbo       AAVERAVSVGSDSEADIHIAHTSTPEGV------DAAKAGGATCEVTPHHLFLSRADATE
1706|gene|nph       DAIERACETADEHGADIHIAHTSTPEGA------DIAREAGMTCEVTPHHLFLSRDDLEE
970|gene|hut        DAVERVCALASEYDVDLHIAHASTPEAI------DAAGAAGISTEVTPHHLFLSRSSLGD
12232|gene|hma      KAVERACEVAQKHDATIHIAHTSTPEGV------DIASEAGMTTEVTPHHLLLSRRDLSE
2704|gene|hhi       EAVERACTVAKEHDATIHIAHTSTPEGV------DIASEAGMTTEVTPHHLLLSRRDLSE
                     ::.*            *: * .   .       .         :     *  .  .   

5304|gene|hhi       RVTFDQYPYTAGSTMLTALLPPWARQGDSEAIRHRLNSVAVRDRIAADISQPGDWENLAY
5296|gene|hhi       HGPFLK------------VNPSLKSDAERERLWDAVQDGTI-DLIGTDHFPTYRETRDVG
1061|gene|hwa       LGTYGR------------MNPPLRSEARRKELWDRLIAGDI-DMIATDHAPHTYDEKAA-
2077|gene|hla       LGTFGR------------MNPPLRSEERRAAVFERLRDGDV-DVVATDHAPHTVAEKRQ-
2533|gene|nrc1      LGTFGR------------MNPPLRSDPRREALFERLADGRI-DVVATDHAPHTRAEKAA-
1816|gene|hvo       LGTYGR------------MNPPLRSEARREAMFERLADGRI-DMVATDHAPHTREEKER-
3960|gene|hbo       LGTYGR------------MNPPLRSEDRREGMWERVVSGEI-DIVATDHAPHTRAEKDA-
1706|gene|nph       LGTFGR------------MNPPLRSETRREAMFERLVDGDI-DIVATDHAPHTRAEKDA-
970|gene|hut        LGTHGR------------MNPPLRREKRRERVYDRVRNGQV-DIIATDHAPHTSEEKDA-
12232|gene|hma      LGTFGR------------MNPPLRREKRRQKLYERVVDGTV-DMIATDHAPHTREEKDA-
2704|gene|hhi       LGTFGR------------MNPPLRREKRRQKLYERVVDGTV-DMIATDHAPHTREEKDA-
                      .. .            : *.   :     :   :    : * :.:*        .   

5304|gene|hhi       AAGSWDNILVTRTGSGRHQGDTIEDIATEMGSEPVDAMCELLVSEELDVT--MADFVMAE
5296|gene|hhi       WDDIWEPYA---------------------GLPGVETMVEFLVSEGVHEDR-IS------
1061|gene|hwa       --SLWDAPS---------------------GVPGVETMLPLLFERARRDE--IS------
2077|gene|hla       --RLVDAPS---------------------GVPGVETLYPLLLESVRKGN--LS------
2533|gene|nrc1      --DIWDAPS---------------------GVPGVETALPLLLGAAHRGE--LS------
1816|gene|hvo       --SLLDAPS---------------------GVPGVETMVPLLLGAVVAGD--LT------
3960|gene|hbo       --DLWDAPS---------------------GVPGVETMLPLLLEEARKGT--IS------
1706|gene|nph       --SIWDAPS---------------------GVPGVETVLPLLLDEARKGR--IS------
970|gene|hut        --DIWDAPS---------------------GVPGVETALPLLLEEARRDH--LT------
12232|gene|hma      --GIWDAPS---------------------GVPGVETVLPLLLAEARDPDSGLT------
2704|gene|hhi       --SIWDAPS---------------------GVPGVETVLPLLLAEARDPDSGLT------
                         :                        *   *::   :*.         ::      

5304|gene|hhi       ADIERFLADDRGTFCTDGIFGGKPHPRAIGAFSRILERYVRERDVLSPELMAYKAAGHPA
5296|gene|hhi       --------------------------------------WPRLREL---------VCAAPA
1061|gene|hwa       --------------------------------------YERIRDV---------TARNPA
2077|gene|hla       --------------------------------------LERVRDV---------VAANPA
2533|gene|nrc1      --------------------------------------YERVRDV---------TAANPA
1816|gene|hvo       --------------------------------------AERVRDV---------VAANPA
3960|gene|hbo       --------------------------------------YERVRDV---------TAANAA
1706|gene|nph       --------------------------------------YERLRDV---------TAANVA
970|gene|hut        --------------------------------------YERVRDL---------MAANPA
12232|gene|hma      --------------------------------------YERVRDL---------TARNPA
2704|gene|hhi       --------------------------------------YERVRDL---------TARNPA
                                                            * *::          .   *

5304|gene|hhi       DILGL-RDRGYVREGYVADLVAFDLDS---VSANATYED----PFQFSD-GM--EYVLVG
5296|gene|hhi       QNAGIYPKKGSLQVGTDADVMLVRTEE-YEVTADGLTFVGGWTPYEGQQWSARVDTVVAG
1061|gene|hwa       SRFGL-NNKGHIAVGYDADLILIDPTATQTIKGNILHSKCTWTPFDGMN-GIFPELTMVR
2077|gene|hla       SIFEI-EGKGRIEPGADADLVVVDLTNPREIEAGALHGASGWTPFEGLQ-GVFPELTTVR
2533|gene|nrc1      DVFGL-ERKGHIAAGRDADLVLVDPDDAREIHGDDLHSNCEWTPFEGHV-GVFPAMTLVR
1816|gene|hvo       DVFDL-PRKGRIEAGADADLALYDLDAAREIRGADLHSNCEWTPFEGHT-GVFPEWTMLR
3960|gene|hbo       EIFDL-PQKGRVEVGSDADLVVFDPEESQEIHGADLHSRCGWTPFEGMR-GVFPEMTLVR
1706|gene|nph       DIFDL-PDKGRIEAGNDADLVVVDPDDAEPIRGDNLNSKCEWTPFEGRD-GVFPELTMVR
970|gene|hut        ALFDL-PRKGRIAPGYDADLVLVDPEATREIRAADLHTKCDWTPFEGWQ-AVFPEVTMVR
12232|gene|hma      DVFDI-PQKGAIEAGKDADLVLVDTTETSEISGAALHSKCDWTPFEGHD-AVFPEWTMVR
2704|gene|hhi       DVFDI-PQKGAIEAGKDADLVLVDTIETSEISGAALHSKCDWTPFEGHD-AVFPEWTMVR
                        :   .* :  *  **:          : .          *::    .     .   

5304|gene|hhi       GEVAVRD------------GELTGARN--GAVLRSYEEWGGATRPALDRAADD-------
5296|gene|hhi       GEVVAK-------------DHEVQSTA--GRGQFLDRPL---------------------
1061|gene|hwa       GTVVYD-------------GESFGSTV--GMNVTTSE-----------------------
2077|gene|hla       GKIAYER-------DPVTGAESFGETV--GRNVRES------------------------
2533|gene|nrc1      GTTVWD-------------GDTVSAFD--GRNVRQ-------------------------
1816|gene|hvo       GEFVWD-------------GDEFGAVA--GENVRD-------------------------
3960|gene|hbo       GHVVYE-------------DGKFGDAV--GENVRN-------------------------
1706|gene|nph       GTVVYR-------------DGEFADAVGHGQNVRA-------------------------
970|gene|hut        GAVVYERD-----------DEDFADHQ--GRNVRLARDVTQEAPQPDEQTTSDGELSSAS
12232|gene|hma      GTVVYERGDALEADDSTAQEDVFYDHQ--GENVRGAD-----SERLE-------------
2704|gene|hhi       GTVVYERGDAL-ADDATPQEDVFYDHQ--GENVRGAD-----SERLE-------------
                    *  .                         *                              

5304|gene|hhi       ---------------------------------------
5296|gene|hhi       ---------------------------------------
1061|gene|hwa       ---------------------------------------
2077|gene|hla       ---------------------------------------
2533|gene|nrc1      ---------------------------------------
1816|gene|hvo       ---------------------------------------
3960|gene|hbo       ---------------------------------------
1706|gene|nph       ---------------------------------------
970|gene|hut        AGTAQPDLDDTGADDEVAEPSGDDTETDDVVAEPGDEVQ
12232|gene|hma      ---------------------------------------
2704|gene|hhi       ---------------------------------------