HOG Organism Gene ID Name Annotation
aHOG1748 hmu HMUK2756 Hmuk_2756 polysaccharide biosynthesis protein
aHOG1748 hut HUTA0537 Huta_0537 polysaccharide biosynthesis protein
aHOG1748 nph NP1944 tp57 transport protein 57 ( polysaccharide biosynthesis transport protein)
aHOG1748 nrc1 VNG1054 ptp probable transport protein
aHOG1748 hma Hma_10427 putative polysaccharide biosynthesis protein
MUSCLE (3.6) multiple sequence alignment


537|gene|hut        MRLGKTALYHFGTQVVISVSGFLATFAIGVFGGSADLGNYTLAVAVGFFWLAIPIS-GVA
10427|gene|hma      MRLGKTALSHFVSQVVVSLAGFAATWLIAVVLGADGLGRYSVIVSLGFFWLVIPGN-AVA
1054|gene|nrc1      MRYGRTSIIHFLSRLVMSVSGFFATIALTRILGQRQYGTYVVVLSV-LAWTTMAAQFGLP
1944|gene|nph       MRIGQTSVIYFLGKVTASVVGFLATIYFARVLGAEVLGFYAVAIAV-AGWLKLGGSMGVS
                    ** *.*:: :*  .:. *: ** **  :  . *    * * : :::   *  :  . .:.

537|gene|hut        QAVNKRMSEGADPGQYFGGGLALNGVLVVCLTAVVSLTSWLLQVVETPNQTIVRVIVEYD
10427|gene|hma      NAMKKRISEGDSPAGFIGGGILLNAVTTAVLGVLILAAGELLGGIVSRNRELMRVLIDYD
1054|gene|nrc1      QAIRKRVSEADG-GNYVYAGAILQFLLYVVLAGCLWIARPYITDFVGIDAAPV-------
1944|gene|nph       SAVQKRMSEGDDPDRYFVAGALMVAAFAAVAVSVLLLFRDQVNAYVGAEAALL-------
                    .*:.**:**. .   :. .*  :     .     :      :      :   :       

537|gene|hut        VEIVILLVGAAAIKTVLFGLQGQKRVARAGALRALDRVVRSGSQVAL---ILLGFGVAAI
10427|gene|hma      VEIVVMLAAAVAYRTTQGSLQGQKRVATTGWLKAGERVMRTALQVGA---LLAAMGVAGI
1054|gene|nrc1      --VIAMLGVRLALRFVQVVLDGQQLVHVSSLLIPVEWSSRSIVQVSL---VVSGVGIAGA
1944|gene|nph       --VALLVTVQLLFAIVGAGLKGQRRVHVYGVLKPLKEASQSLTQVALVVPVLFGLGLTGL
                      :  ::        .   *.**. *   . * . .   .:  **.    :: ..*::. 

537|gene|hut        TLGHAASLLFVSIVAIVLAPIRPSVPRLEHLRGLGEYAKYAWVGALRSRVYGWLDTLVLG
10427|gene|hma      ALGHASSLAIAAGVAFLLSERRPALPTVDQLRSLVDYAKYAWMGALRGRVFGWLDTIFLS
1054|gene|nrc1      FAGYVAGATVAVLVGLYFIDVPRTMPARDEFTSLRSFAQFSWLGSIKSRMFQSMDTLVLA
1944|gene|nph       LAGKAIGAFLVTLLAIAVLGVSFKRPTLEHFKSLLDFAKYSWLGSVESRTFKEADIVIMG
                      * . .  ..  :.: .       *  : : .* .:*:::*:*:: .* :   * :.:.

537|gene|hut        IFLTGTTGASLIGIYEVAWGIGSLLATASASISSTLFPEMSDLSS-DGDYDRVAHFLDEA
10427|gene|hma      FFVS----ASLIGIYEAAWGIASMLAIASSSISQTLFPEVSDLST-ADGYDRIVHYLDEA
1054|gene|nrc1      VFVS----HSLVAVYEVAWNLASLFAIFGSSIARTLFPEMSGISANSEDTSKIAGLLRVS
1944|gene|nph       FFVS----SALIGVYSIAWSLTMFLTLFGSSVRTTLFPEISNAAS-TKGKDAIS-LIEDG
                    .*::     :*:.:*. **.:  :::  .:*:  *****:*. ::   . . :   :  .

537|gene|hut        LAFSGVIVLPGLVGAITIGERILRFYSGEYVRGYVVLVILVGAYTADVYANQLLNTVNAV
10427|gene|hma      LAFSSILVIPGLVGAAVIGDRVLRFYRPEFDQGATVLLILIAAYLADAFASQFTNVINGV
1054|gene|nrc1      LAYSGLFIIPGLVGSALVGDIILTIYGDGFRTGYRILLVLTFARLLYGYSRQFLSTIDAL
1944|gene|nph       ISYQGLILIPGFVGGTILSEQILQIYGDEFVQGTAVLWILILAVLLKGYQSQFLTALNGL
                    :::..::::**:**.  :.: :* :*   :  *  :* :*  *     :  *: ..::.:

537|gene|hut        DRPDASMRVNAVFILVNVVLNVVLVWQFSWVGAAVATAVSASVRTAGGGIVVHSILEEAP
10427|gene|hma      DRPDAAFRVNMVFIVSNAILNAVLIWQLSWTGAAIATALSSLLRALIGYWVLGNIVGSIH
1054|gene|nrc1      DRPKLTLYINVAFVGTNLLLNVLLTWRFGWYGAATATTVSSAISLAGGYYYARRLV-NVT
1944|gene|nph       DRPDISFYIYTAFILSNLILNVTLIYLFGWVGAAIATALSAGVGLSLSYIAVKRLS-SFK
                    ***. :: :  .*:  * :**. * : :.* *** **::*: :    .      :  .  

537|gene|hut        LPIRPIGSQVVASIAMGGAIV-----------LLAPSVPAGRLWTISLVGAGATIYFTVL
10427|gene|hma      IPYRTLGTQVAAATVMAAAVS-----------PVAMLMPPGRLGTLLLAGFGGVVYAVVL
1054|gene|nrc1      VPIGEISRQWLAALLMAGIVVAG-------RTLVGDSLPAG----IVLVAVGGGVYFAAL
1944|gene|nph       TPTEMIAKQLTSALLMGIFVYAGLYIEQTFGLIEYNAITVG-----ILVFSGALLYFVLL
                     *   :. *  ::  *.  :                 :. *      *.  *. :* . *

537|gene|hut        IALSGRFRTKVQSLVPAVVSV----
10427|gene|hma      VIISARVRAKARLVMPETTL-----
1054|gene|nrc1      TALSEEFRTTVDDNIPFDIRHRWDG
1944|gene|nph       FVLSEEFRRTTRRNLPGFG------
                      :*  .* ..   :*