HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0174COG1389arCOG01165/3DNA topoisomerase VI subunit BDNA topoisomerase VI subunit B

HOG Organism Gene ID Name Annotation
cHOG0174 nrc1 VNG0885 top6B DNA topoisomerase VI subunit B
cHOG0174 hmu HMUK2728 Hmuk_2728 DNA topoisomerase VI, B subunit( EC:5.99.1.3 )
cHOG0174 hma RRNAC0457 top6B DNA topoisomerase VI subunit B
cHOG0174 hwa HQ2653A top6B DNA topoisomerase VI subunit B
cHOG0174 hla HLAC1314 Hlac_1314 DNA topoisomerase VI, B subunit
cHOG0174 hbo HBOR16540 Hbor_16540 DNA topoisomerase VI, B subunit( EC:5.99.1.3 )
cHOG0174 hut HUTA0130 Huta_0130 DNA topoisomerase VI, B subunit
cHOG0174 hvo HVO_1571 HVO_1571 top6B DNA topoisomerase VI B subunit
cHOG0174 nph NP3482A top6B DNA topoisomerase VI subunit B
cHOG0174 hhi 1178 top6B DNA topoisomerase VI subunit B
MUSCLE (3.6) multiple sequence alignment


885|gene|nrc1       MTSFQSTLDDDEDG--IAEELAASQREISVAEFFEKNKHMLGFDSGARGLVTAVKEAVDN
3482|gene|nph       MTSYQSQLGDGGGGEPIAEELAESQQSISIAEFFEKNKQMLGFDSDAKALVTAVKEAVDN
130|gene|hut        ---MQSTLGE-EG---IAEELAESQRQISIAEFFEKNKHMLGFDSGARALVTAVKEGVDN
10457|gene|hma      MTSYQSQLGEGEG---IAEELAESQRAISIAEFFEKNKHMLGFDSEARALVTAVKEAVDN
1178|gene|hhi       MTSYQSQLGEGEG---IAEELAESQRAISIAEFFEKNKHMLGFDSEARALVTAVKEAVDN
1314|gene|hla       MTSFQSTIGDEEG---IAEELAEGQREISIAEFFEKNKHMLGFDSGARGLVTAVKEAVDN
2653|gene|hwa       MTSFQSTLGEEGE---IADELAESQRAISIAEFFEKNKHMLGFDSGARGLVTAVKEAVDN
16540|gene|hbo      MTSFQSTLGEDAG---IAEELAESQRAISIAEFFEKNKHMLGFDSGARGLVTAVKEAVDN
                        ** :.:      **:*** .*. **:********:****** *..*******.***

885|gene|nrc1       ALDATEEAGILPDIYVEISEGRDYYTLIVEDNGPGITNAQIPKIFGKLLYGSRFHAREQ-
3482|gene|nph       ALDAAEEAGILPDIYVEIEDRGDYYRLTVEDNGPGITKEQIPKVFGKLLYGSRFHAREQ-
130|gene|hut        SLDACEEADIFPDVYVEIEDVGEYYRLVIEDNGPGITREQLPKVFGKLLYGSRFHKREQ-
10457|gene|hma      ALDACEEAGILPDIYVEIQESGDYYKLVVEDNGPGITKEQAPKIFGKLLYGSRFHAREQ-
1178|gene|hhi       ALDACEEAGILPDIYVEIQESGDYYKLVVEDNGPGITKEQAPKIFGKLLYGSRFHAREQ-
1314|gene|hla       ALDATEEAGVLPDIYIEIEEVGDYYRLVIEDNGPGITKEQLPKVFGKLLYGSRFHAREQ-
2653|gene|hwa       ALDATEEAGIKPDISIEIRESGDYYTLIVEDNGPGITREQVPKVFGKLLYGSRFHAREQS
16540|gene|hbo      ALDATEEAGIKPDISVEIRESGDYYTLIVEDNGPGITKEQIPKVFGKLLYGSRFHAREQ-
                    :*** ***.: **: :** :  :** * :********. * **:*********** *** 

885|gene|nrc1       ------------------------------------------------------------
3482|gene|nph       ------------------------------------------------------------
130|gene|hut        ------------------------------------------------------------
10457|gene|hma      ------------------------------------------------------------
1178|gene|hhi       ------------------------------------------------------------
1314|gene|hla       ------------------------------------------------------------
2653|gene|hwa       LTPTQTLLIRRDGDVTFTSIGDFCDSYLPADGPASAPIPVDANIEVPSFDRATHEMTWQP
16540|gene|hbo      ------------------------------------------------------------
                                                                                

885|gene|nrc1       ------------------------------------------------------------
3482|gene|nph       ------------------------------------------------------------
130|gene|hut        ------------------------------------------------------------
10457|gene|hma      ------------------------------------------------------------
1178|gene|hhi       ------------------------------------------------------------
1314|gene|hla       ------------------------------------------------------------
2653|gene|hwa       VTNAIRHRTDERVYRISTACGRTLEITGNHSLFSLSSDNETIEVNAGELSPGDSILAPKQ
16540|gene|hbo      ------------------------------------------------------------
                                                                                

885|gene|nrc1       ------------------------------------------------------------
3482|gene|nph       ------------------------------------------------------------
130|gene|hut        ------------------------------------------------------------
10457|gene|hma      ------------------------------------------------------------
1178|gene|hhi       ------------------------------------------------------------
1314|gene|hla       ------------------------------------------------------------
2653|gene|hwa       LPMASESVDTSTTVDEKTQSSTGAQTQRINILEHIKPDDLKESAATFRIHEADQASLSSG
16540|gene|hbo      ------------------------------------------------------------
                                                                                

885|gene|nrc1       ------------------------------------------------------------
3482|gene|nph       ------------------------------------------------------------
130|gene|hut        ------------------------------------------------------------
10457|gene|hma      ------------------------------------------------------------
1178|gene|hhi       ------------------------------------------------------------
1314|gene|hla       ------------------------------------------------------------
2653|gene|hwa       GNHKSPSASLASSQLASSEVIASAGGQQIQSSADQRQSKGHTPGGDHHNNECLLIKSVCE
16540|gene|hbo      ------------------------------------------------------------
                                                                                

885|gene|nrc1       ------------------------------------------------------------
3482|gene|nph       ------------------------------------------------------------
130|gene|hut        ------------------------------------------------------------
10457|gene|hma      ------------------------------------------------------------
1178|gene|hhi       ------------------------------------------------------------
1314|gene|hla       ------------------------------------------------------------
2653|gene|hwa       NDKMSTVADYTLEIVTPDGESSRLPVSVSIDNVFITSLVRYIATASTSDISPVSDSSVDY
16540|gene|hbo      ------------------------------------------------------------
                                                                                

885|gene|nrc1       ------------------------------------------------------------
3482|gene|nph       ------------------------------------------------------------
130|gene|hut        ------------------------------------------------------------
10457|gene|hma      ------------------------------------------------------------
1178|gene|hhi       ------------------------------------------------------------
1314|gene|hla       ------------------------------------------------------------
2653|gene|hwa       TTEERHNTVDRSFSDTMRPLDSVIPLICEDDGEIELPSFVFESDPKRQQQLLTQLYRYPE
16540|gene|hbo      ------------------------------------------------------------
                                                                                

885|gene|nrc1       ------------------------------------------------------------
3482|gene|nph       ------------------------------------------------------------
130|gene|hut        ------------------------------------------------------------
10457|gene|hma      ------------------------------------------------------------
1178|gene|hhi       ------------------------------------------------------------
1314|gene|hla       ------------------------------------------------------------
2653|gene|hwa       ASNGRNAGDDTVTYTTTSATLARQLTTLWNMNGVVATTNTQTETSQSDEIENESAQTTIY
16540|gene|hbo      ------------------------------------------------------------
                                                                                

885|gene|nrc1       ------------------------------------------------------------
3482|gene|nph       ------------------------------------------------------------
130|gene|hut        ------------------------------------------------------------
10457|gene|hma      ------------------------------------------------------------
1178|gene|hhi       ------------------------------------------------------------
1314|gene|hla       ------------------------------------------------------------
2653|gene|hwa       EVSVDRAEIETDIAGSDSDCQQGDGDLCLVSVSSVEEIDAPPYVYDISVPGASGHDENFV
16540|gene|hbo      ------------------------------------------------------------
                                                                                

885|gene|nrc1       -----------SRGQQGIGISAAVLYSQLTSGKPVRIESRTQDSETANVYELIIDTDTNE
3482|gene|nph       -----------TRGQQGIGISAAVLYSQLTSGKPAKITSKTDSHSSAQYFELTIDTDTNE
130|gene|hut        -----------NRGQQGIGISAAVLYSQLTSGKPAKITSRTKGSEEAHYFELIIDTDTNE
10457|gene|hma      -----------NRGQQGIGISAAVLYSQLTSGKPAKITSRPKGQDEAQYFELIVDTDTNE
1178|gene|hhi       -----------NRGQQGIGISAAVLYSQLTSGKPAKITSRPKGQDEAQYFELIVDTDTNE
1314|gene|hla       -----------SRGQQGIGISAAVLYSQLTSGQPAKITSRPKGQSRAQYFELIIDTDTNE
2653|gene|hwa       TANDGAICVKNSRGQQGIGISAAVLYSQLTSGKPARITTRTQSSDTAQYFELIIDTDTNE
16540|gene|hbo      -----------SRGQQGIGISAAVLYSQLTSGKPAKVTSRTQGDSAAQYFELIIDTDTNE
                               .********************:*..: :.... . *: :** :******

885|gene|nrc1       PEISAETEVSAAKSDLRGTHGTRIEMALDANMRARGQLHDYIKHTAVVNPHARIELQEPG
3482|gene|nph       PEIDHERE-----ATWERPHGTRIELEMEGNMRARKQLHDYIKYTAVVNPHARVEFHEP-
130|gene|hut        PEIDVDET-----TTWDRPHGTRIEVELEANLRARQQLHDYIKHTAVVNPHARIEFHEPN
10457|gene|hma      PEISVDET-----TTWERPHGTRIELEMEANMRARSTLRDYIQDTAVVNPHARVEFDEPG
1178|gene|hhi       PEISVDET-----TTWERPHGTRIELEMEANMRARSTLRDYIQDTAVVNPHARIEFDEPG
1314|gene|hla       PEIKADEE-----TTWDRPHGTRIELEMEANMRARNQLHDYVKHTAVVNPHARFELREPG
2653|gene|hwa       PEVSADQERDPGAASLSPTHGTRIELEMEANMRARGQLRDYVKDTAVVNPHARITLDEPG
16540|gene|hbo      PEIQVEHELAPGESDLSPTHGTRIEVEMEANMRARQQLHDYVKHTAVVNPHARLVLDEPG
                    **:. :       :    .******: ::.*:***  *.**:: *********. : ** 

885|gene|nrc1       GE--LKSERAEEASLPAETDEILPHPHGVELGTLIKMLAETDSHSVSGFLQSEFTRVGSK
3482|gene|nph       -EDSFKSERATE-ELPPETEEIRPHPHGVELGTLLKMLDATDSYSLSGFLQAEFTRVGNK
130|gene|hut        MAEPAKFERVEGADLPAETKEIRPHPHGVELGTLLKMLEATDSYSVSGFLQGEFTRVGGK
10457|gene|hma      LDESLKFERAERAELPDETEEIRPHPHGVELGTLLKMLEATDSYSVSGFMQEEFTRVGGK
1178|gene|hhi       LDESLKFERAERAELPDETEEIRPHPHGVELGTLLKMLEATDSYSVSGFMQEEFTRVGGK
1314|gene|hla       LDEPLKFERATD-ELPAETEEIRPHPHGVELGALIKMLEATESYSVSGFLQEEFTRVGKK
2653|gene|hwa       LEEPRQYERVDGAELPAQTEEIRPHPHGVELGTLLKMLEATESYSVSGFLREEFTRVGSK
16540|gene|hbo      LDEPLRYERVEGAGLPDETEEIRPHPHGVELGTLIKMLSRTESYSVSGFLQEEFTRVGAK
                         . **.    ** :*.** *********:*:***  *:*:*:***:. ****** *

885|gene|nrc1       TATGIIDAFRDEHFGREMRWRPP-------ADAD-------LEATVADAVANKDATHTAV
3482|gene|nph       TADGVIDSFRDRHFGREMAWSPPQP----HEDVD-------IETAVSDAVANKSAEATAA
130|gene|hut        TSDKVLDNFRDRHFGREMAWRPPQV-----HEGD-------VEVAVRAAVANKGKDATKS
10457|gene|hma      TADSVIANFNDRHYGRGMAWQPPKV----NEDAD-------IERAVEDAVANKGAETTAT
1178|gene|hhi       TADSVIANFNDRHYGRGMAWQPPKV----GEDAD-------IEAAVEDAVANKGAETTAT
1314|gene|hla       TADSVIDNFRDVYYGRELAWSPPRA----HDDRD-------VAAAVAGAVANKGKAATTD
2653|gene|hwa       TATKILDQFRDRHFGRALPMSAPETIPDNADGTDDEQVTSSLESIIEAAVVNKGASATTT
16540|gene|hbo      TADKILNNFRDRHFGREMGWSVPDT-----DETD-------LDAAITDAVANKGADATAT
                    *:  ::  *.* ::** :    *          *       :   :  **.**.   *  

885|gene|nrc1       FARTVADAVRDADSIAPAELGALVADAAADAQDDTGTSFGETVQANVVAAVRDALT----
3482|gene|nph       FARAVADEVTDMAALSHAELSAVVASVADDIEAEHDETFGETVRENAVEAAWKSVT----
130|gene|hut        FAREVADAIDDRERVAHHELRAIVDEAAEAAAEGFGTTFGSTVREKATAAAWAQLIGNTD
10457|gene|hma      FAAAVSDAIHDRDRVAYHEVESIVDSAAEDAEADGDTTFGATVRENAVDAAWNAVS----
1178|gene|hhi       FAAAVSDAIHDRDRVAYHEVEAIVDDAAEDAEADGDTTFGSTVRENAVDAAWGAVT----
1314|gene|hla       FADGIAETVAGNDRLSRSELATIVDNVAETVEDDTGKTFGGTVRENAVDAAWQAISGAGD
2653|gene|hwa       FASRVAETVNQRSGTTQGELVGIVDTVAEDIEDEFETTFGTTVRENAVEAAWDVLT----
16540|gene|hbo      FAERVGDTLRNRERTTHFELGDIVDTVANDIESEFDVTFGDTVRENAVEAAWDILV----
                    **  :.: :      :  *:  :*  .*         :** **. :.. *..  :     

885|gene|nrc1       -----------------SDRVADVLGPVDEATTVQKDDATVRGLAERIAAKFES-GGDTD
3482|gene|nph       -----------------DDVSADCYALVDGATTTRKDDAAVEGLSRRLAEKFTDQEDARN
130|gene|hut        EGDVR------------ETLASDLYGLVDAATSKRKDDATIEGLADRIAAKFVD-EDDRH
10457|gene|hma      -----------------DNLSSDLYALVDDVTTKRKDDAAVEGLASRLADKF-D-DDGRH
1178|gene|hhi       -----------------ADLTGDLYALVDDVTTKRKDDAAIEGLASRLADKF-D-DDGRH
1314|gene|hla       DDGAGDSEDGENVDPSESSLVADAYALVDDATSTRKDDAAVRAMAEALARRFENLDGDAF
2653|gene|hwa       -----------------TDIDEDIYPLVADATSTQKDHETVRGVTDRIATKFAD-GSEPL
16540|gene|hbo      -----------------TDRTADLYALVDDATSTRKDDETVHGLAERVAEKF-D-SSAAH
                                          *    *  .*: .**  :: .::  :* .* .  .   

885|gene|nrc1       RVTRDTLDEYVFRAAENTAEYADATIGETARENVADALWARMATVPDDPPNTSALADDRD
3482|gene|nph       RFRRSTLREFVDRAADATEEYDDATFGETARENVVEAVWERAVTVPDEPPTVTEVADNRD
130|gene|hut        RCTRDQLAEYVERAAENTEEYDDATIGETARENVTTEIWAIMETVPDDVPNVTEIADNRD
10457|gene|hma      RLTRDELRGYIDRAADMTEEQDDATFGETARENVLEALWTAAEGVREEPPKVSDIADDRD
1178|gene|hhi       RLTCDELRGYIDRAADMTEEQDDATFGETARENVLEALWTAAEGVPEEPPKVSDIADDRD
1314|gene|hla       RITRDDLERLVADAASFVTEQHDVTFGETARENVVETFWSRARTVPDDPPKVTAIAGDRD
2653|gene|hwa       RATRDAVREYVDRSADMIVS-EEVSFGETARENVVDAVWTAMQTVDDELPAVKAVADDRN
16540|gene|hbo      RATKKQVREYVDRSADLLVS-DDVSFGDTARENVTESLWEVMRTVPDDVPKVRDVADDRD
                    *   . :   :  :*.   .  :.::*:******   .*     * :: * .  :*.:*:

885|gene|nrc1       AASDLLAAMASVNVMAPPTSCLSPIEADQLEAGLRTEFDADFYAAATRDADVHGGDPFIV
3482|gene|nph       AAARLLEAMRSTDILSPPTDCLAPISEDLVKAGLKKEYDAEFYTSVTRDASVHGGDPFVV
130|gene|hut        VAADLLEAMRETDIISPPTDCLAPISERLVEEGLRKEFDADFYAASTRDASVHGGDPFIV
10457|gene|hma      TASQLLSAMRETDIIAPPTDCLSPISAELVEEGLRKEFDADFYAASTRDASVHGGDPFIV
1178|gene|hhi       TASQLLSAMRETDIIAPPTDCLSPISAELVEEGLRKEFDADFYAASTRDASVHGGDPFIV
1314|gene|hla       ASADLLEAMRTTDILAPPTDCLAPITAELVEAGLRKEYDADFYAAATRDAEVHGGDPFIV
2653|gene|hwa       IASDLLEAMRLTDILAPPTDCLSPITADLVEAGLRKEFDADFYAAATRDAEVHGGDPFIV
16540|gene|hbo      TASELLEGMREADILAPPTNCLSPITDELVEAGLRKEYDADFYAAATRDAEVHGGDPFIV
                     :: ** .*  .::::***.**:**    :: **..*:**:**:: ****.*******:*

885|gene|nrc1       EAGIAYGGDIDSEGGVQLMRFANRVPLVYQRGACATTDVLGDIGWRNYNLSQPGGSGLPQ
3482|gene|nph       EVGIAHGGDIAVDGSVETLRFANRVPLVYQRGACATVDVLKGVNWRNYGLDQPGGSGMPS
130|gene|hut        EAGIAYGGELDEGGPVDVMRFANRVPLVYQRGACATTDVVKTINWRNYGLDQPGGSGIPK
10457|gene|hma      EAGIAYGGELESEGTVDVMRFANRVPLVYQRGACATTDVVKSIRWRNYNLDQPGGSGIPK
1178|gene|hhi       EAGIAYGGELEAEGTVDVMRFANRVPLVYQRGACATTDVVKSIRWRNYNLDQPGGSGIPK
1314|gene|hla       EAGIAYGGEIPAEGSVELLRFANRVPLVYQRGACATTDVIKSIGWRNYGLDQPGGSGLPN
2653|gene|hwa       EAGIAYGGELE-GGKISLLRFANRVPLVYQRGACATTDVIKSIGWRNYGLDQPGGSGMPN
16540|gene|hbo      EAGIAYGGDLQSEGSVDLLRFANRVPLVYQRGACATTDVVKRIGWRNYGLDQPGGSGMPK
                    *.***:**::   * :. :*****************.**:  : ****.*.******:*.

885|gene|nrc1       GPAVIMVHVASTNVPFTSESKDAIANVPEIEAEIELAVREAARELKSFLQKRQSMRKRQQ
3482|gene|nph       GPAVIMVHVASTSVPFTSESKDAVANIPEIEDELRLALQQAGRDLQSHLKKQRSLEKRRR
130|gene|hut        GPAVVMIHVASTNVPFTSESKDAIANIPEIEDEIELAIREAARELKSFLNERRSRRQRRE
10457|gene|hma      GPAVIMVHVASTNVPFTSESKDAIANVPEMEDEIELAIREAARELKSYLNKRRSMQQRRE
1178|gene|hhi       GPAVIMVHVASTNVPFTSESKDAIANVPEMEDEIELAIREAARELKSYLNKRRSMQQRRE
1314|gene|hla       GPAVISIHIASTNVPFTSESKDALANVPAIEDEIELAVREAARELKSYLNKRRSMQQRRE
2653|gene|hwa       GPAVVMIHVASTNVPFTSESKDALANIPAIEDEIELAVREASRELKSYLNKRRSMQKRRE
16540|gene|hbo      GPAVIMVHVASTNVPFTSESKDALANIPEIEDEIELAIREASRELKSYLNKRRSMQKRRK
                    ****: :*:***.**********:**:* :* *: **:.:*.*:*:*.*::..*  :*. 

885|gene|nrc1       KQDVIMDILPTMAEKVGELTGRGGVDVSDSLARIMNNVLVERARSDDGQTVTLRVENHGT
3482|gene|nph       KQDVIADILPDMAAKLSEVTDREPLDVEDSLARIMNNVLVERTVEES--TVQLSVHNYGD
130|gene|hut        KQDKLGTILPEMATKLTAVTGRAELNIDDSLARIMNNVLLEREREDG--TVSLVVENNDS
10457|gene|hma      KQDKLATILPEMAEKLTEVTDNDELHIDDSLARIMNNVLVEREVEDD--TVRVRIENNDD
1178|gene|hhi       KQDKLATILPEMAEKLTEVTDNDELHIDDSLARIMNNVLVEREVEDD--TVRVRIENNDD
1314|gene|hla       KQDVLGRILPEMADKVSEVTGRPRPDIDSALARIMNNVSVEREVNDE--TVTLVVENHSD
2653|gene|hwa       KQDVLGRILPEMANKLADVTENDRPDIDNALARIMNNVSVERNVDNG--SVTLTVQNYSD
16540|gene|hbo      KQDVLGRILPEMADKLAEVTKQDRPNIDGALARIMNNVSVEREVADD--TVTLAVENHSD
                    *** :  *** ** *:  :* .    :..:******** :**   :   :* : : * . 

885|gene|nrc1       GSVDVDVTDIVSAEPDGV---GDDASVVAMDDEYFVKWTPAVAGDDAAELTYSVDADADC
3482|gene|nph       TNVGPEVTDIVSQEPDGA----ESATVVEMDGEWFLKWSPTVGGGETATLEYEVDGDAEF
130|gene|hut        TNADVEITDIVTAEPANVEADGDDARVVEMEGEWFIKWSPTVSSGDEAALSYEVSDDAEF
10457|gene|hma      TNADVELTDIVTAEPQVT----NGATVVEMDGEWFVKWSPTVGAGETAVLEYSVTDEAEF
1178|gene|hhi       TNADVELTDIVTAEPQVT----NGATVVEMDGEWFVKWSPTVGAGETAVLEYSVTDEAEF
1314|gene|hla       VNEQLEITDIVSAEPTDL----SDGTVVDMDGEWFVQWKPEVPSGDERELTYAIDGDADF
2653|gene|hwa       RQESPTLTDIVDSKPDTI---PDEIEIVELEDEYFLTWEPVVDAGESATVTYEVPTGASF
16540|gene|hbo      RTEQPDITDIVTAEPTDV---PDDATVVDLDGEWFVKWNPSVSAGETAELTYTVTSDASF
                          :****  :*       .   :* ::.*:*: * * * ..:   : * :   *. 

885|gene|nrc1       ELSVSGVADARLTVSEADT
3482|gene|nph       DISVEGIEAEKLTVDA---
130|gene|hut        DISVEGIAEEKLTVDGEQ-
10457|gene|hma      TVSVDGIEEEKLTVNA---
1178|gene|hhi       TVSVDGIEEEKLTVNA---
1314|gene|hla       EVSVGGVETEKLTVNA---
2653|gene|hwa       ELDVDDVETEKLTIDA---
16540|gene|hbo      DINVDGVETEKLTVNT---
                     :.* .:   .**:.