HOG Organism Gene ID Name Annotation
aHOG1733 hbo HBOR13820 Hbor_13820 predicted membrane protein, COG3174
aHOG1733 hmu HMUK2208 Hmuk_2208 magnesium transporter accessory protein
aHOG1733 nph NP4320 hypothetical protein
aHOG1733 nrc1 VNG1525 vng1525 no entry
aHOG1733 hma Hma_10990 mgtC1 magnesium transporter accessory protein
MUSCLE (3.6) multiple sequence alignment


1525|chp|nrc1       MFPRPTALPTAARMNPSLDAHVSRSAMLYHAVSGHGTKATRLRRSLVPYNELLFTASSGR
13820|hp|hbo        ------------------------------------------------------------
4320|hp|nph         ------------------------------------------------------------
10990|gene|hma      ------------------------------------------------------------
                                                                                

1525|chp|nrc1       ERPGPKRHRQARTGRWAADVVGCVDPPRLTAGAPPGPWGDLDPVFMCTPANVLVVTVTVD
13820|hp|hbo        -------------------------------------MPLLSPLVLQG-----------G
4320|hp|nph         -------------------------------------MSELGPAM---------------
10990|gene|hma      -------------------------------------MGAMSTLL---------------
                                                            :.. .               

1525|chp|nrc1       ALVAAPLDSRIVRIAVAVALGLFLGLEREWAQKAAGIRTFALVSVLGAIFTMVDTERCAA
13820|hp|hbo        DVLSAPLSNDVVRLVLAALLGMFLGLEREWSEKSAGIRTFALTSLVAAVFTLVASKSELG
4320|hp|nph         ------LDDNVAALVLAALLGLFLGLEREWSDKVAGIRTFALVSLIAAVFTILGEP----
10990|gene|hma      QLSPEPIQATVFRILLAGALGMFLGLEREWSQKSAGVRTFALISLLAAVFTLVENQ----
                          :.  :  : :*  **:********::* **:***** *::.*:**::       

1525|chp|nrc1       AGGACPPVLGGVGAVFVIVLTGVLMVSGLR--SSEGTLHLTTAVSMLVAYGIGVLAALGA
13820|hp|hbo        G------SLLAVGAVLVVVQGILLAVHGLR-QRDGTGLSLTTSVSLMAAYGVGTLVALGY
4320|hp|nph         -------LLLFVGAAFVVVVGVILGIRGLV--GQTETLSLTTSASLLVAYGVGSLVASGH
10990|gene|hma      -------ALLVVGGVLVIVQGILLAVQGLLDDGEEEGLSLTTSVSMLVAYGIGALVAQGF
                            *  **..:*:*   :* : **    .   * ***:.*::.***:* *.* * 

1525|chp|nrc1       VLPATVVAVTSSILLVFKRELHGFAWGLSREELRSTTEFAILAFVVYPVLPTGAMTVGRG
13820|hp|hbo        ALQGVTVAVVSSLLLVLKRELHGLAGRLDREEIRSTAEFAILAFVAYPILPAESYTLYGI
4320|hp|nph         VLEGVTVTVVSSLLLVLKQELHAVAGSLSRQEVRSSTEFAILAFVIYPLLPPEERTIAVG
10990|gene|hma      ILEGVSVAVFSSLLLVLKRELHSLAWGLSREELRSATEFAIIAFVIYPLLPSEPVEIPGG
                     * .. *:* **:***:*.***..*  *.*:*:**::****:*** **:**.    :   

1525|chp|nrc1       GWVVEIEPRVVWSMVVFVAAIGIVNYVVVQAYGGCGIAVTGFFGGLASSTAVVGTLLDHV
13820|hp|hbo        TID---DPRVAWLMVVTVAGIGIVNYAVVQQYGGRGIAVTGFFGGLASSAAVVGTMLDHV
4320|hp|nph         DAAVAVEPRVVWLMVVFVAGIGIANYAIVQLYGGRGIAVTGFFGGFASSTGVVGAMLDHV
10990|gene|hma      LVDVAVELRVIWLMVVFVAGIGIVNYGIVQTYGGRGIAVTGFFGGLASSTAVVGTMLDHV
                          : ** * *** **.***.** :** *** **********:***:.***::****

1525|chp|nrc1       DAHADATRYAVAGVLLANAAMALRNLLIVVVFTASAGVLVTGTLPLAVIVTGSIAIAAVT
13820|hp|hbo        RQQPEAYRYGVAAVLLADAAMSVRNLFIAITFTATSRPLLGVVLPLGCLIVGSVAAAWFA
4320|hp|nph         SQQPDASRYGIAAVVLSNAAMAMRNLAIAVVFTIGAGVLVEAVIPLGAVVVGAIVVAAFT
10990|gene|hma      RQRPDATSYAVAAILLADAAMALRNLLITVFFTIQRGVLVEAIIPLGAVIVGSVVVAAYT
                      ..:*  *.:*.::*::***::*** *.: **     *:   :**. ::.*::. *  :

1525|chp|nrc1       ADWSQSVSMDLDTPFSMRNALGFGAMFLVVVVAGGLAETQFGSAGLLVTAVVSGLVSSAG
13820|hp|hbo        ADWSQEVTIPLESPFSLRNAFGFGFVFLVILVVGTMAQGQLGTLGLYASTFISGFVSSAG
4320|hp|nph         AEWSESVEMDLGAPFTLRYALGVGGLFLVVLLAGGFAEALFGTEGLYAAAAISGLVSSAG
10990|gene|hma      ADWSETVDMGLESPFSLRNALAFGGVFLLVVVAGGFAETQFGTAGLYITSALSGLVSSAG
                    *:**: * : * :**::* *:..* :**::::.* :*:  :*: **  :: :**:*****

1525|chp|nrc1       ATTSAVVLYRTNAVDADTAAIAVLLATASSIGVKAGLSATSANRTFAARVVAYSAGLLVV
13820|hp|hbo        ATTTAVLLYRGGTISPTAATVAILLATAASVLAKAILAVTGPS-EFRRAVSIWSFGLLVA
4320|hp|nph         ATASAVILYSNGQITADQAVVAILLASAASIAVKAGLSALSPNREFARGVVVWSAVLLVG
10990|gene|hma      ATTSAVLLYRGGAIDGPTAMVAILTATAASIMVKAALTASGPNRAFATRVAFWSSVVLGV
                    **::**:**  . :    * :*:* *:*:*: .** *:. ...  *   *  :*  :*  

1525|chp|nrc1       GGGAAVVLAA----
13820|hp|hbo        VGALTGGFVVLGIV
4320|hp|nph         AGAVTGLVVLL---
10990|gene|hma      ATVLALGLLI----
                        :  .