HOG Organism Gene ID Name Annotation
aHOG1732 hbo HBOR37100 Hbor_37100 Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases)( EC:1.1.1.100 )
aHOG1732 hmu HMUK2767 Hmuk_2767 short-chain dehydrogenase/reductase SDR( EC:1.1.1.100 )
aHOG1732 nph NP1900 dehydrogenase/ reductase 5
aHOG1732 nph NP4370 dehydrogenase/ reductase 3
aHOG1732 nrc1 VNG1341 fabG 3-oxoacyl-[acyl-carrier-protein] reductase
aHOG1732 hma Hma_11984 fabG4 3-oxoacyl-[acyl-carrier protein] reductase
MUSCLE (3.6) multiple sequence alignment


4370|gene|nph       ----------MPTDQFSVDGQNVIVTGASQGIGRGIAERFAADGANVAICSRAQERIDPV
1900|gene|nph       -----------MLEQFSVEGQTAVITGSSQGIGAVTAKRFADEGANVVVTSRTQEQIDEV
1341|gene|nrc1      -----------MTDRSVVSG-TAIVTGASSGIGRATAERLAADGARVVLCSRDHADVDAV
37100|gene|hbo      ----------MTADRFGVDGQTAIVTGASSGIGKTIAERFAAEGANVVVCSREQGNVNPV
11984|gene|hma      MPEMSDAMSKPHTERFRLENQRAIITGASSGIGRAIAEEFAADGADVVVCSREQDNVGPV
                                 :.  :..  .::**:*.***   *: :* :** *.: ** :  :. *

4370|gene|nph       AESIR-EDG-GTALAVECNVREPEDVEAFVEATAEEFGGIDVLVNNAGGEFVAAFEDISE
1900|gene|nph       ADEINDSDRPGEAIAVECDVREREAVEALVEATVDEFGRIDSMINNAGASFMAGFDDISE
1341|gene|nrc1      ADAIR-TDG-GTALPVECDVTDRDAVDALVEATVHEFGGLDVLVNNAGASFVAPFDDISR
37100|gene|hbo      ADGINEGDG-GRALAVECDVTDREAVEALVEATVEEFGDLDCLVNNAGASFMSSFDDISA
11984|gene|hma      ADEINDSDRPGEAVAIECDVTDREAVEALVEATVDEFGGLDVLVNNAGASFMSGFDDISE
                    *: *.  *  * *:.:**:* : : *:*:****. *** :* ::****..*:: *:*** 

4370|gene|nph       NGWKSIIDLNLHGTFHCTQAAGEYMR-DDGGGCIINMSSVNGQHAAPNESHYSASKAAII
1900|gene|nph       NGWKTIVDINLHGTFHCSQVAGQQMQSQDGGGTIVNFASVAGTMGSQYMSHYGAAKAAVV
1341|gene|nrc1      NGWDRIIDVNLGGTYNCTQAAAEQLK-RDGGGAVVNVASVAGQEGSPHMSHYAAAKAGII
37100|gene|hbo      NGWETVVDINLTGTYHCTQVAGEYLK--DGGGTVINLASVAGTEGAPFMSHYGAAKAGVV
11984|gene|hma      NGWKTIVDINLHGTYHCTQAAGDALA-ADGGGTVINLSSVAGEQGAPYMSHYGAAKAGVS
                    ***. ::*:** **::*:*.*.: :   **** ::*.:** *  .:   ***.*:**.: 

4370|gene|nph       RLTETLAVEWASDGIRVNCIAPGLVQTPGVAETLGIQEDQMPPRETVDRRIGHTEDIADV
1900|gene|nph       NLTTSLSAAYADENIRVNCIAPGLVGTPGVASQMGLDPSDV-DREDVAKEMGLPEEIADI
1341|gene|nrc1      TLTRTLAAEWAPAGVRVNCIAPGFVATPGLDAQMGVSAADI-DRREVARRIGTSAEIADA
37100|gene|hbo      NLTTTLAYEWADENVRVNCIAPGFVATPGVESQMGVSADNI-DREEVKRRIGTAEEIADL
11984|gene|hma      NLTSTLSAEWADRDIRINCIAPGFVATPGVESQMGVSADNI-DREAVERRIGLSEEIADI
                     ** :*:  :*  .:*:******:* ***:   :*:.  ::  *  * . :* . :*** 

4370|gene|nph       AQFLASDAAAFMTGETVTAKGVPRPGNSFEVDLGLQ
1900|gene|nph       VQFLASDAASYIVGETITAQGVPPLEDS-NL-----
1341|gene|nrc1      IRFLASPAASFVVGETLTAAGVPQGEEVPSP-----
37100|gene|hbo      AQFLASPASSYIVGETVVAQGVPQVMESPEV-----
11984|gene|hma      ALFLASPASSYIVGQTITAAGVPRLEETPDI-----
                      **** *::::.*:*:.* ***   :  .