HOG Organism Gene ID Name Annotation
aHOG1730 hmu HMUK0742 Hmuk_0742 conserved hypothetical protein
aHOG1730 nph NP3634 hypothetical protein
aHOG1730 nrc1 VNG2431 vng2431 no entry
aHOG1730 hma Hma_7269 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


3634|hp|nph        MKPCQNCQTVIDEYILDKQLEPLRELTADDFSVCADCVTIVADACVECGGAVYVPRSESV
7269|hp|hma        MQLCQNCQAAIDEYLLDKQLEPLRDLTVDDFNLCADCVTVVADACVECDGAVYVPRSETA
2431|chp|nrc1      MQPCHNCQSVIDEYTLDKQLDGLRELTVDDFNLCADCVTVVDDACVTCGGAVYVPESATK
                   *: *:***:.**** *****: **:**.***.:******:* **** *.****** * : 

3634|hp|nph        TPDYCPACRSDLISRTGDDPGWTRCQASN
7269|hp|hma        VPDCCPACRSEHIDETGTDPGWHFDTVST
2431|chp|nrc1      PPHYCPACRGDLLAG-GHDPGWRSDVVSD
                    *  *****.: :   * ****    .*