HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0173COG0420KOG2310arCOG00397DNA repair exonucleaseprobable mre11/rad32 gene DNA repair exonuclease

HOG Organism Gene ID Name Annotation
cHOG0173 nrc1 VNG0512 mre11 probable mre11/rad32 gene DNA repair exonuclease
cHOG0173 hmu HMUK2899 Hmuk_2899 metallophosphoesterase
cHOG0173 hma RRNAC1841 yhcR2 phosphoesterase
cHOG0173 hwa HQ1700A mre11 DNA double-strand break repair protein mre11
cHOG0173 hla HLAC0182 Hlac_182 metallophosphoesterase
cHOG0173 hla HLAC2790b Hlac_2790 metallophosphoesterase
cHOG0173 hla HLAC3129b Hlac_3129 metallophosphoesterase
cHOG0173 hla HLAC3236b Hlac_3236 metallophosphoesterase
cHOG0173 hbo HBOR23660 Hbor_23660 DNA repair exonuclease
cHOG0173 hut HUTA0370 Huta_0370 metallophosphoesterase
cHOG0173 hvo HVO_0853 HVO_0853 mre11 DNA double-strand break repair protein mre11.
cHOG0173 nph NP1518A DNA repair operon protein ( DNA repair exonuclease)
cHOG0173 hhi 2361 yhcR3 phosphoesterase
MUSCLE (3.6) multiple sequence alignment


3129|gene|hla       -----MKLMFTRDDLPRNDRLSNPITVL-VREVSPSSSNKLDFEVTVEDADGHTISLKIW
3236|gene|hla       MMEDALELLYTGDLHLGRHPSRIPDDLDGPELSPKAVWLSTVQEAIDQDVDTVVIAGDIV
2790|gene|hla       ----MTQILHVSDTHLDKRQYGQDL----RRADFADAFDASVDIAIDEGVDAVIHTGDLF
1700|gene|hwa       ----MTRVIHTGDTHIGYQQYHSQI----RREDFLNAFNQVITDACDADVDAVIHAGDLF
1518|gene|nph       ----MTRVLHTGDTHIGYRQYHTPE----RREDFLSAFRQVADDAVEMDVDAVVHAGDLF
512|gene|nrc1       ----MARVIHTGDTHLGYQQYHAPQ----RRQDFLDAFDAVITDAIDEGVDAVVHAGDLY
182|gene|hla        ----MTRVIHTGDTHMGYTQYHSPV----RRQDFLDAFAAVIDDAIEGEVDAVVHAGDLF
23660|gene|hbo      ----MTRVIHTGDTHIGYQQYHSPE----RRRDFLDAFEQVVADAIADDVDAVVHAGDLF
370|gene|hut        ----MTQVLHTGDTHLGYRQYHSPE----RQGDFLSAFQQVIDDAIEADVDAVVHAGDLF
11841|gene|hma      ----MTRVIHTGDTHVGYQQYNVPD----RRDDFLDAFRQVVRDAIADDADAVVHAGDLF
2361|gene|hhi       ----MTRVIHTGDTHVGYQQYNVPD----RRDDFLDAFRQVVRDAIADDADAVVHAGDLF
                           ::.. *                               .    .*    : .: 

3129|gene|hla       STHSLSLSLTEGHR---YELEDVRGRYWSQGGSRHYQLDSTKDLTV--TELGPADDTATR
3236|gene|hla       DQENRYFEAYGAFEDGIAQLDEAGIPVVVVAGNHDFDALPEMVDNLDSDTLQFLGREGQW
2790|gene|hla       DDPTPSVPAVNRCLDTIGRLEDAGIPFLAIVGNHERKREEQWMDII--KRFGNAKRLSKS
1700|gene|hwa       HDRRPSLTDLLGTIDILRDLREADIPFLAVVGNHESTRHGQWLDLF--ERLGLAERLDNS
1518|gene|nph       HDRRPGLVDLLGTVDILETLDSAGIPFLAIVGNHETKRDAQWLDLF--ETMGLATRLGDE
512|gene|nrc1       HDRQPGLRDILDTIALLRPLQDADIPFLAVVGNHEGTRDAQWLDLF--ETLGLAERLDDS
182|gene|hla        HDRRPELTDLMGTISILRRLDDAGVPFLAVVGNHESTRGGQWLDLF--ERLGLATRLGDD
23660|gene|hbo      HDRRPELRDLLGTISILRQLDDAEIPFLAVVGNHESTRGGQWLDLF--ENLGLAERLGDD
370|gene|hut        HDRRPRLQDILGALGTLRELDAASIPFLAIVGNHEGKRDAQWLDLF--ESLDLAIRLDEE
11841|gene|hma      HDRRPALTDIMGTLTVLEELSEAGIPFLAVVGNHEAKRDAQWLDLY--ESLGLATRLDDE
2361|gene|hhi       HDRRPALADIMGTLTVLEELSEADVPFLAVVGNHEAKRDAQWLDLY--ESLGLATRLDDE
                          .            *  .        *..                :         

3129|gene|hla       LLIVGDT-------HVGYRHRRRDKKAKGAKDLDARDRFQAVMDQ--ANTLD--------
3236|gene|hla       ERWTLEQDGEPVAHFDGWSFSAEHVYESPLEEYDLPETDDAPQIGVLHADLDS-----RG
2790|gene|hla       PTVVTDANGDDPVSVYGIDAIRSPEWDGYDFTLGESESNDHVTILCMHELVQPLVPEHRG
1700|gene|hwa       PRYINDN-----LALYGLDHVPPSRREELAYEFNPHEATHAALVS--HGLFTP----FAH
1518|gene|nph       PVPVGET------AFYGLDFVPRNQRDDLEYEFATHDCEHAALVS--HGLFEPLVPDYGN
512|gene|nrc1       PRVVADT------AFYGLDYVPQSKRDDHDYTVADHDADHAALVS--HGLFTP----FPY
182|gene|hla        PTVVGDT------SFYGLDHVPVSRRDDLDYAFDDHDADYAALVA--HGLFEP----FGY
23660|gene|hbo      PHVVGDT------AFYGLDHVPKARRDDLAYDFEPHDAAHAALVG--HGLFTP----FAH
370|gene|hut        PTVIGET------AFYGLDFVARAARDDLAYDFEPHDTTHAALVS--HGLFQP----FSH
11841|gene|hma      PTVIGDT------AFYGLDFVPRSQRDDLDYDFGPHDADSAALVT--HGLFQP----FDY
2361|gene|hhi       PTVVGDT------AFYGLDFVPRSQRDDLDYDFAAHDADSAALVT--HGLFQP----FDY
                         :          *                   :             .         

3129|gene|hla       -----ADAIVHAGDI-FDHVAIGADRSFVIDALN---------------SELNIPFYYIY
3236|gene|hla       SRYA-PVLSSELRDTPADAWLLGHIHSPGIQIDSRPLALYSGSPQPLDPGEQQAHGPWTI
2790|gene|hla       DPYDLSEDILDRLNFLPTALALGDYHSTCNDTVDGVKVFYPGATERCKVSERGTPSVYLL
1700|gene|hwa       ADWE-TETVLTTASVDFDALLLGDNHAPGVETVEDAWVTYCGSTERTSTAEESARGYNLV
1518|gene|nph       VEWD-IEAVLEASNIDFDAVLLGDEHAATKQEVADTWVTYCGSTERTSASERDDRGYNLV
512|gene|nrc1       ANWD-LDAVLADATVEFDAVLLGDNHTPDTAQLGDTWVTYCGSTERASASERDPRGYNIV
182|gene|hla        ADWD-TETVLTESDVDFDAMLLGDNHTPDVAKVDGTWVTYPGSTERASASEREGRGYNLV
23660|gene|hbo      ADWE-TETVLGESNVAFDAFLIGDNHAPGTEQVDGTWVTYCGSTERASAAETEARGYNLV
370|gene|hut        GDWD-AEAILEQATVDFDAMLLGDDHTPARREVDGTWLTYCGSTERASASEREARGYNLV
11841|gene|hma      GDWD-AEEILTESSVEFDAMLLGDNHDPGKQQVEDAWVTYCGSTERASASERADRGYNIV
2361|gene|hhi       GDWD-AEEILAESSVTFDAMLLGDNHDPGKQQVEDAWVTYCGSTERASASEREDRGYNIV
                                         :*  .                       .*         

3129|gene|hla       G--------NHDEPASRRTVDG------------ATNDTSEIERL------------LKN
3236|gene|hla       TIPK-----NGEVRAEQILLAS-------VRYDQVSVDVSGVEDPQEATSVISEEIKEHV
2790|gene|hla       NIQ------DGELSRKTRAISTAGRENVPRPFLTVNIDFDETHSL------------DHA
1700|gene|hwa       TF-------DTDVDIRRRSLET-------RPFVFVSVDLATGEGT------------ERV
1518|gene|nph       TF-------DGAVRISRRGIKT-------RPFVFVDLELGATEGF------------NYV
512|gene|nrc1       SFSSDA---TTDVAISRKSLNT-------REFVFVDADLGPTDGT------------AFI
182|gene|hla        TFDADAAGGDDRVEIRRRALDT-------RPFVFVEVDLREGEGA------------ARV
23660|gene|hbo      TF-------DDEVDIRRRSLDT-------RPFAFVSVELADDEGA------------ERV
370|gene|hut        TF-------DDGVDIRRRSIET-------RPFVFVDLELAAGEGA------------ERV
11841|gene|hma      TF-------DDEVQITRRGLDT-------REFVFVDVDLGPKEGV------------ERV
2361|gene|hhi       TF-------DDEVRITRRGLDT-------REFVFVDVDLGPEEGV------------ERV
                                       :              .  :                      

3129|gene|hla       GESVGE------TDV--TLFGIDYSHDSFPGEPLEASVQSVLSNANVLVVHDTPYPVRN-
3236|gene|hla       RSELDT------RSLELSLVRVHLTGRTDA--------------HSALVDR---HRSME-
2790|gene|hla       ATRIDEDAGGMNDDISDMVVVARLTGANVGVTA--KDVYDLMAEREVAVPYVDDKRQPD-
1700|gene|hwa       CDRLRE------YDLGDAVVVIEITGDGDSVPP--ATIETFATDHGALVARVTDRREHP-
1518|gene|nph       RDRLLE------YDLDDAVVRVTLDGDGEDVSP--ARIESFATDEGALVARVTDNRTIDV
512|gene|nrc1       QERLRE------RALDDAVVVVTITGDGDTVTP--AEIERFGDDRGALLTRVNDRREFDT
182|gene|hla        REKVRQ------HDLGDAVVLVDVTGEGDPVTP--AAIEEFATDEGALIARVTDRREVET
23660|gene|hbo      REQVRQ------HDVDDAVAIVEITGEGEPVTP--ASIEEFLSERGALVARVTDRRSMET
370|gene|hut        RTRVGQ------HDLEDAVVIVTIEGEGERVPP--ATIEEFARDRGALVARVNDRREID-
11841|gene|hma      RSRVGQ------HDLEDAVVIVSISGDGDPVTP--ASVESFALDRGALVARVTDHREITA
2361|gene|hhi       RSRVGQ------HDLEDAVVIVSISGDGDPVTP--ASVESFALDRGALVARVTDHREITA
                       :          :   :                           . :           

3129|gene|hla       ENGYHIHQKRGAD-------FRKAIEQ----------TSVEIDLIVSGHM--HVGQQGTL
3236|gene|hla       ------RDLGF---------RERSVSVRIESIDVDTRPAIDLEDLAEGDNAA--------
2790|gene|hla       ----VDFDFDFDDEQTESQNPDKMLDDAVGGLEIST-ITTEADDLVRDDTVDDDDIRPEM
1700|gene|hwa       EERNIDTTVSFAD-------PDAAVEQRIRELDLST-AAHDIDTMIRSDSISDSNIRNTV
1518|gene|nph       DADAP--DIAFAD-------PDKAARERVRELGLSE-MGRQLDETVRDGEIADSNLSDEI
512|gene|nrc1       GDDAPDVDVSFAD-------PDDAVEQRVRDLGLDE-PARDVDRIVRDDTLADAAVRERV
182|gene|hla        D---AEIDVSFAD-------PEDAVRERVEEMGLSE-AAFDVEEAVRADTIPDTNVRETV
23660|gene|hbo      E---TEVDVSFAD-------PDDAVRERVSDLGLST-AALDVDETVRASKTADANVREEV
370|gene|hut        EE--AAYDVRFAD-------PDDAVRDRIDQLGLSP-AAAELDEVVRASKVADSNVDDSV
11841|gene|hma      EER--ETDISFAD-------PDDAVTERVRDLGLSE-AAHDIDETIRASKVADANVKDEV
2361|gene|hhi       EEQ--ETDISFAD-------PDDAVTERVRDLGLSE-AAHDIDETIRASKVADANVKDEV
                                                            : :                 

3129|gene|hla       DEFQTPVLVT--------------------------------------------------
3236|gene|hla       -AYLADLLLE--------------------------------------------------
2790|gene|hla       NTHIR-------------------------------------------------------
1700|gene|hwa       TEEISELLNNESLDAFTQTSSADTNTFDKTTSTSPEGTQSDSSILSADYTTNSPSSNKET
1518|gene|nph       ERRVESALEDGGL-----------------------------------------------
512|gene|nrc1       IQRAEAVLDD--------------------------------------------------
182|gene|hla        KRRVEERIDDLDD-----------------------------------------------
23660|gene|hbo      KTRVDSLLESDDLDAFTPADTDGTESEGKE------------------------------
370|gene|hut        ESRVRELVDEGDAEQFKPAPA-------------------EGDGEADD------------
11841|gene|hma      ERHVRELLSEDSD-----------------------------------------------
2361|gene|hhi       ERHVRELLSKGSD-----------------------------------------------
                                                                                

3129|gene|hla       -----------------GAPAPINSGK---------------------------------
3236|gene|hla       ---------------IENGDTRESYGN------------------------MVDDSLAAV
2790|gene|hla       ------------------TEQKEQFGE---------------------------------
1700|gene|hwa       ENHTPFVQQPQSTVKDDDTDTKIDSDDMSNDENMDIIADTNRFTNISQDANTDTDTTANI
1518|gene|nph       -------EDIAGTAADADTGDNGEAGD----------------SGATTGSESERADGKTG
512|gene|nrc1       -----------------DADAADDDGR---------------------------------
182|gene|hla        -------LDAFDRGETVDGDAEAEDNE-----------------------AELADDEAEL
23660|gene|hbo      -------STPSATDVTTETDATDESDD-SIETAATTEANTTDEDEVAVETHGTTDTDATV
370|gene|hut        -------GDNMEAGDSDDTEGSDSDDEPAGDSIADAPAEDGTESEGSEANDTQANGEGTD
11841|gene|hma      -------------ALEADTDAAASGGT-----------------------ADAEANTDTA
2361|gene|hhi       -------------ALAADAETAASDGA-----------------------DSTDAAASTD
                                           . .                                  

3129|gene|hla       -EDNNPSTWLLRVTESGVD-----------------GITRHPL--------
3236|gene|hla       RQAHSANAYNPLRRETELRDPDDNDAIEHLEQQA--RVLLDTLLSQKGGNA
2790|gene|hla       -------------------------------------ATLEER--------
1700|gene|hwa       GSDSNAEPSIDRTEETELSDDESDTSETDESNSASSQFTMEDF--------
1518|gene|nph       PSDTGDAGETGDARTEAESNESSQTQETDGQPAENGQSSMEEYL-------
512|gene|nrc1       ------------------------------------PTTVEEFQ-------
182|gene|hla        ADDETDGEPIGGKDDTATASAADIDE----------QVSMEDYL-------
23660|gene|hbo      GTDETTDTDTTVDTDTEDDTATDADAENGNAEPNQ-QFTMEDF--------
370|gene|hut        GPDQPNDGQTEK-DGNQPNDEQTDDGEG--------QATMGEYL-------
11841|gene|hma      EDDTDDGAAVNEADDKAPVDGADDDG----------QASVEEFL-------
2361|gene|hhi       EDDTEDGAAVNEA------DGTDDDG----------QASVEEFL-------