HOG Organism Gene ID Name Annotation
aHOG1726 hbo HBOR22100 Hbor_22100 arabinose efflux permease family protein
aHOG1726 hla HLAC1768 Hlac_1768 major facilitator superfamily MFS_1
aHOG1726 hmu HMUK0910 Hmuk_0910 major facilitator superfamily MFS_1
aHOG1726 hmu HMUK1619 Hmuk_1619 major facilitator superfamily MFS_1
aHOG1726 hut HUTA0223 Huta_0223 major facilitator superfamily MFS_1
MUSCLE (3.6) multiple sequence alignment


22100|gene|hbo      MARSVGGSLGLLKDREFAALAGTAFARSQAYSTILIALALYADQFG-----------TTG
1768|gene|hla       MSNADAGNGA--KRSQFWALYLTRFAEGFGFITLITLLGTYINTLDPQATTVLGVSISAG
223|gene|hut        MALSN-------DELQFSSLYVMRFAGSFGFMSVLTLLPDFIEALG-----------ATG
                    *: :        .  :* :*    ** . .: :::  *  : : :.           ::*

22100|gene|hbo      FVEGLFGTAFAVVQLLIVLPLGRKVDTGNAKHYLLAGLVVNVAVFIGFTQVQNSTHVVLM
1768|gene|hla       LIIGMYTTGFTLAQTVAVVPLAWAGDRFDKRTVLLGVLAIGAGVYALFPLVDSSASFILV
223|gene|hut        LTIGVFVTALELARTVGIVPIAWAGDRYSKKTVLLIGLALSVLAYLTFAVISSIEGFLGA
                    :  *:: *.: :.. : ::*:..  *  . .  **  *.:.. .:  *. :..   .:  

22100|gene|hbo      RMVQGLGASLLWITGSTVVGEISPDDSSGRWLGAYNQVAAFSSLAGDVIGGYLLYAYQTY
1768|gene|hla       RALQGLVVTGAGLMTLSLVGQIADVGTRADKIGKANAASFAASIVGSLSAGAIYDAVGFD
223|gene|hut        RFLQGLGMTGVGLLGLALIGDLAPADSRANYIGKYNAFRMAAGIVAPIGGGILYEVTGFD
                    * :***  :   :   :::*:::  .: .  :*  *     :.:.. : .* :  .    

22100|gene|hbo      VVYMALSAVTIAAFLLVWRYLRENPGGRKDPEEATGTETLRALLDRPMIRSLVFFRLAFS
1768|gene|hla       PIFMIIALLMVAAWVITWLVLDD------DDTRVEGFPFSDLAVNRRIL-TMTSFRAQYA
223|gene|hut        VLFLLVATLLAVAAVGIWRFVDA------DETTVEGFAFTDLAINRRIL-TMVTFRAQYA
                     ::: :: :  .* :  *  :        *   . *       ::* :: ::. **  ::

22100|gene|hbo      VGKMAVIIFLPIF-----AHKQFGINAFAIGWILAGGKLTKTVAQGYMGDLTDRLGSKHW
1768|gene|hla       FAVTMVRTWVPIYVSTEMAAGGLGVTGIAIGVTVTAEKATNMVGQLFTGRLSDDYG-RSL
223|gene|hut        VAVTLVRKWVPIFVGLNAAQGGLAYGAGVTGVVVAAEKFTNMLSQPYTGRLSDRWG-REP
                    ..   *  ::**:     *   :.  . . *  ::. * *: :.* : * *:*  * .  

22100|gene|hbo      FVAVGAALYGIGTALIPL-----ALYFEGVVTPIEFSAFGKTQALGGAFFALFAAYGVLG
1768|gene|hla       FVFAGGGAYGLIAMAIPFSAVIGTALGAGVTLPI-------LGELPAAYLPLVAFSGLLG
223|gene|hut        FIIAGGSAYGLFGIAFPF--ITGAEGLFRVSVPI-------AGTVTGAVLAAIVLNGLIG
                    *: .*.. **:    :*:     :     *  **          : .* :. ..  *::*

22100|gene|hbo      VADSIRLPASMALFVEEGERFDSVASSMSLRSISWKIGQVAGPALVGTIKDVVSTTAAFL
1768|gene|hla       IADSFREPASMALFADEGTDDGGVASSFGIRELVWRPGSVAGPLIAGWLMIEVNMASVFY
223|gene|hut        IADGFREPASMALFADEG-KGEGIASSFGIRSLVWKPGSVLAPLVGGWLMGAAGIEWVFF
                    :**.:* *******.:**    .:***:.:*.: *. *.* .* : * :   ..   .* 

22100|gene|hbo      TAAAFIIVATGIFLVTYYLTSRVESPRPVTSD
1768|gene|hla       VGGAFAITGVLAFLAILAHDHGRAALTAW---
223|gene|hut        LGGAAALSGVATFTSILASRHGREALRPA---
                     ..*  : ..  *           :  .