HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0172COG0105KOG0888arCOG04313Nucleoside diphosphate kinasenucleoside diphosphate kinase

HOG Organism Gene ID Name Annotation
cHOG0172 nrc1 VNG1160 ndk nucleoside diphosphate kinase
cHOG0172 hmu HMUK2624 Hmuk_2624 Nucleoside-diphosphate kinase( EC:2.7.4.6 )
cHOG0172 hma RRNAC0106 ndk nucleoside diphosphate kinase
cHOG0172 hwa HQ2882A ndk nucleoside-diphosphate kinase
cHOG0172 hla HLAC1845 Hlac_1845 nucleoside diphosphate kinase
cHOG0172 hbo HBOR12090 Hbor_12090 nucleoside diphosphate kinase( EC:2.7.4.6 )
cHOG0172 hut HUTA0753 Huta_0753 Nucleoside-diphosphate kinase
cHOG0172 hvo HVO_2740 HVO_2740 ndk Nucleoside diphosphate kinase
cHOG0172 nph NP3666A ndk nucleoside-diphosphate kinase
cHOG0172 hhi 861 ndk nucleoside diphosphate kinase
MUSCLE (3.6) multiple sequence alignment


1160|gene|nrc1      MTD----HDERTFVMVKPDGVQRGLIGDIVTRLETKGLKMVGGKFMRIDEELAHEHYAEH
753|gene|hut        MSH----HDERTFVMAKPDAVQRGLIGEIVSRLEERGLKLVGAKFMQIDEDLAHEHYGEH
2882|gene|hwa       MSEEAPVH-ERTFVMVKPDGVQRGLIGEIISRFEDRGLTLVGGKFTRLDTEVARDHYGEH
1845|gene|hla       MSH----HDERTFVMVKPDGVQRGLIGEIVSRFEERGLKLVGGKFMQIDEDLAHQHYGEH
3666|gene|nph       MAD----T-ERTFVMVKPDGVQRGLIGDIVSRFEDRGLKLVAGKFMQIDDELAREHYAEH
12090|gene|hbo      MSD------ERTFVMVKPDGVQRGLIGEIVSRFEDRGLKMVAGKFMQIDEELAHEHYGEH
10106|gene|hma      MSE----H-ERTFVMVKPDGVQRGLIGDIVSRFEDRGLKMVGGKFMQIDQELAEEHYGEH
861|gene|hhi        MSE----H-ERTFVMVKPDGVQRGLIGDIVSRFEDRGLKMVGGKFMQIDQELAEEHYGEH
                    *:       ******.***.*******:*::*:* .**.:*..** .:* ::* :**.**

1160|gene|nrc1      EDKPFFDGLVSFITSGPVFAMVWEGADATRQVRQLMGATDAQDAAPGTIRGDYGNDLGHN
753|gene|hut        EDKPFFDGLVEFITSGPVMAMVWEGADATRQVRQMMGATDPAEAAPGTIRGDYGLDLGHN
2882|gene|hwa       KDKPFFDDLVSFITAGPVFAMVWEGADATRQVRSMVGETDPAESAPGTIRGDYGLDLGRN
1845|gene|hla       EGKPFFDGLVDFITSAPVFAMVWEGADATRQVRSMVGETDPAESAPGTIRGDFGLDLGQN
3666|gene|nph       VDKPFFDELKEFITSGPVFAMVWEGQDAVAQVRTMMGETDPAESAPGTIRGDFGLDLGRN
12090|gene|hbo      KDKPFFDGLVDFITSGPVFAMVWEGQDATRQVRRMMGETDPAESAPGTIRGDYGLDLGRN
10106|gene|hma      EDKPFFDGLVDFITSGPVFAMVWEGQDATRQVRTMMGETDPAESAPGTIRGDYGLDLGRN
861|gene|hhi        EDKPFFDGLVDFITSGPVFAMVWEGQDATRQVRTMMGETDPAESAPGTIRGDYGLDLGRN
                     .***** * .***:.**:****** **. *** ::* **. ::********:* ***.*

1160|gene|nrc1      LIHGSDHEDEGANEREIALFFDDDELVDWDRDASAWVYEDLADHD
753|gene|hut        IIHGSDNEDPGANEREIELFFDDEELVDYERADAEWVYEDTGDH-
2882|gene|hwa       VIHASDHEDEGANEREIQLFFDESELYTYERIDDPWLYE------
1845|gene|hla       VIHASDHEDEGANEREIDLFFDEEELVDYGLDTAAWVYEDEQH--
3666|gene|nph       VIHGSDTE-PGSAEREIGLFFDDDELQDYERIDEPWLYE------
12090|gene|hbo      VIHGSDHEDEGANEREISLFFDEDELVDYERIDETWLYE------
10106|gene|hma      VIHGSDHEDEGANEREIELFFDEAELVDWDQIDSSWLYE------
861|gene|hhi        VIHGSDHEDEGANEREIELFFDEDELVDWDQIDAPWLYE------
                    :**.** *  *: **** ****: **  :      *:**