HOG Organism Gene ID Name Annotation
aHOG1714 hla HLAC0555 Hlac_555 hypothetical protein
aHOG1714 hmu HMUK1143 Hmuk_1143 protein of unknown function DUF583
aHOG1714 hut HUTA0346 Huta_0346 protein of unknown function DUF583
aHOG1714 hma Hma_10202 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


346|hp|hut        MVSKRSLSRTNVRTITALVVVFLLLASIPGTAFAETRTG--GSVVVGADE----------
555|hp|hla        -MSLSSSTARRRRLAVALALVALLSPLAAGLATAQSVQGASGTIVVDEGETVDRVEGVAG
10202|hp|hma      --MSSRLSSGGIRVATLAVVSLVLLSAVTGTVAAQSYQGASGTIVIGPDETYDSVEGVAG
                         :    *  .  .:  :* .  .* . *::  *  *::*:. .*          

346|hp|hut        ------TVAGDLDVFAGSVAI--HGTVEGNVRAVGGTVRIDGTVTGNVSATAGSVVIGPD
555|hp|hla        TIVVHGTVEGDLSGAAGLIRIAETGRVDGNVQVAAGTVVVDGAVGGNAELGAGSFELTET
10202|hp|hma      TVIVRGTVTGDIATAAGTVHVTETGEVGGNIEAAAGTVRIDGTVGGDVSVAGGTVEIGET
                        ** **:   ** : :   * * **: ...*** :**:* *:..  .*:. :   

346|hp|hut        ATIEGSLTGASGDVTIAGSVQGDVQVGAEIVRVTETAEIAGNLEY-GGTLERASGASIAG
555|hp|hla        GRIDGSLDAGAGSISVDGAVGGDVRAAADSVVIGPNADVGGEFRYDAGTFTQSPDATVAG
10202|hp|hma      AQIDGNLDVGASYLALRGTVDGTVQAGAEEFVLGPTASVGGDVRYDAATFTRAPEAAVGG
                  . *:*.*  .:. ::: *:* * *...*: . :  .*.:.*:. * ..*: .:. *::.*

346|hp|hut        TISADSDLGFDSPLGFS---IPSWIVGIYAFMVGLLGAVILLGLFPDFSRSVATAGTAQP
555|hp|hla        GVVEDTSLRGDTGVGFGGDLVPLWFGSAYGVAVNLVLGAVLLLAFPRFSDDVADRVSEGP
10202|hp|hma      SVVRDESIGASAGPEFGEFALPSWFGVVYGLFVNLLLGAILLAIFPSFSARVAGHVAERP
                   :  * .:  .:   *.   :* *:   *.. *.*: ..:**  ** **  **   :  *

346|hp|hut        LRSGAIGIVALVGIPVGLVVLVLTIVGIPLALIGLFIYLLGLWVGSLYGRYAVGTFVLTQ
555|hp|hla        LASGGVGLLALIATPIFLALVAITIVGIPLALVGIVAYVVALWIGSVYGRYALGSWVLDR
10202|hp|hma      AKSGGVGLLALVAVPVVLVVLLFTIVGIPLSLVGAVAFGVAAWVAVVYGQFAIGSWALSL
                    **.:*::**:. *: *.:: :*******:*:* . : :. *:. :**.:*:*::.*  

346|hp|hut        LDTENRWLALLTGFLAVAALGRLPVAGGLIQLVVLLVGLGGLAATLLERYR---GQRSNG
555|hp|hla        LDSPNRWVALLLGVVGVALIGLVPWIGELVDLLVLLLGLGALALALWGRYR--------G
10202|hp|hma      ADRENRWLALVVGLVGFALLGAIPVLGGLLELVAFLLGLGALALTLRESYRNRGAEPSGG
                   *  ***:**: *.:..* :* :*  * *::*:.:*:***.** :*   **        *

346|hp|hut        EGETATDGRSERVVP
555|hp|hla        RDDAIVSDSDPVEMD
10202|hp|hma      RQTTLDESAGDTAAA
                     :  .. .