HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0171COG1234KOG2121arCOG00500Metal-dependent hydrolases of the beta-lactamase superfamily IIIhypothetical protein

HOG Organism Gene ID Name Annotation
cHOG0171 nrc1 VNG1503 vng1503 no entry
cHOG0171 hmu HMUK2119 Hmuk_2119 beta-lactamase domain protein( EC:3.1.26.11 )
cHOG0171 hma RRNAC0963 hypothetical protein
cHOG0171 hwa HQ2927A elaC ribonuclease Z (RNase Z) (tRNA 3 endonuclease)
cHOG0171 hla HLAC1860 Hlac_1860 beta-lactamase domain protein
cHOG0171 hbo HBOR12310 Hbor_12310 metal-dependent hydrolase, beta-lactamase superfamily III( EC:3.1.26.11 )
cHOG0171 hut HUTA2921 Huta_2921 beta-lactamase domain protein
cHOG0171 hvo HVO_2763 HVO_2763 atsA metal dependent hydrolase
cHOG0171 nph NP4346A hypothetical protein
cHOG0171 hhi 1591 HAH_1591 beta-lactamase domain-containing protein
MUSCLE (3.6) multiple sequence alignment


2921|gene|hut       MQLTFLGTGSAMPTGNRHQTGLLLEAE---GNRLLIDCGSGVLDALAATERGYIDLDAVL
2927|gene|hwa       MRLTFLGTGSPMPVADRAQTGSLLTTD-NNDRALLVDCGSGVLQRLAATEVGYEDISSVL
10963|hp|hma        MRLTFLGTGSAMPTGSRMQSGYLLERD---GNRLLVDCGSGVLHSLAQTDTGYEGVDTVL
1591|gene|hhi       -----------------MQSGYLLERD---GKRLLVDCGSGVLHSLARTDAGYEGVDTVL
1860|gene|hla       MELTVLGSGSAMPVPDRVQAGYLLDDG---DRSLLVDCGSGVLQRLAGTETGYEGVSTVL
4346|hp|nph         MRVTFLGTGAAMPSGDRFQTGLLLEDSGGTASPLLVDCGSGVLHGLARTDGGYEAPGTVL
12310|gene|hbo      MRVTFLGTGSAMPLPDRVQTGLLVESD---ERSLLVDCGSGVLNRLTNTDVGYEGIGTVL
1503|chp|nrc1       MQLTFLGTGSAMPTGQRMQTGLLVEDG---DSRLLVDCGSGVLHTLARTDVGYEGVDTVL
                                      *:* *:         **:*******  *: *: **   .:**

2921|gene|hut       LTHHHLDHVADLLPLVKARWLAGASDLCIAGPPGTRDLLDELLDVHTYLRKHVDPDATDI
2927|gene|hwa       LTHHHIDHVTDLLPLMKARWLAGETYLEIVGPAGTKRLIDDLLEIHEYLSDQIELRIREV
10963|hp|hma        LTHHHLDHVSDLDVLMKARWLAGETDLTIAGPPGTSDLVRDLLETHDYMQDRLDLTLRDL
1591|gene|hhi       LTHHHLDHVSDLDVLMKARWLAGETELTIAGPPGTSDLVRDLLETHDYMQDRLDLTLRDL
1860|gene|hla       LTHHHLDHVAALLPLMKARWLAGEEHLEVVGPAGTKSLLDGLLDVHEYLDGRIDLAVREV
4346|hp|nph         LTHHHLDHVADLLPLLKARWLAGETDLELVGPAGTAALIEDLLSVHEYLQGRVAITVREL
12310|gene|hbo      LTHHHLDHVSDLLALLKARWLAGETHLEVVGPTGTKRLLDGLLDVHDYLQDRVELRIREV
1503|chp|nrc1       LSHHHLDHVSDLLALLKARWLAGEETLTVVGPAGTDALVTDLLGVHDYLQGRVDVTLREV
                    *:***:***: *  *:*******   * :.**.**  *:  **  * *:  .:     ::

2921|gene|hut       EPG-ATTLAGFDVVARAVQHSMAGFGYRVSPAG----------------ADAPTVVVSGD
2927|gene|hwa       GPT-EFTVTDFDIEARRTEHSVDGLAYRITEPTQEQDISADAQSEESDADESATVVFSGD
10963|hp|hma        DGG-PFELAGFSGDTCETRHSMQCFAYRLSVDD------------------GPAITLGAD
1591|gene|hhi       DGG-PFELAGFSGDTCETRHSMQCFAYRLSVDD------------------GPAITLGAD
1860|gene|hla       SAARPFAAAGFDVTARETRHSMDGFAYRFSPPS--AD----------FDPANGPLTLSGD
4346|hp|nph         SAG-SATVAGYDVTAVETDHSMDGLAYRFETDD-------------------AIFTFSGD
12310|gene|hbo      TAG-SFEVAGFEIEATETRHSKDCLAYRFHGDSDAGD----------DDRSGGDFVFSGD
1503|chp|nrc1       DVG-SVGVAGFDVTAIETEHSMPGLAYRFGGDD-------------------GDLVFSAD
                            :.:.  :  . **   :.**.                         .....*

2921|gene|hut       TRAFPAFLSTADGAEVLVHDCSFPDDVETDTHATPGSLGEALAAAEASIGTVYLTHLYPH
2927|gene|hwa       TEATNRIARLADGAAVLVHDCSFPDGVDVSGHPTPSQLANVL--NGITVGRVYLTHLFPH
10963|hp|hma        SEAFTDLIEFADGSAVLVHDCSFPDDVDVSNHPTPTTLGETLRDADAEVGRVYLTHLYPH
1591|gene|hhi       SEAFTDLVEFAEGSAVLVHDCSFPDDVDVSNHPTPTTLGATLRDADAEVGRVYLTHLYPH
1860|gene|hla       TEAFAGMASFADGSDLLVHDCSFPDGTDVSNHPNPTQLGESL--AGTDIDTLLLSHLYPH
4346|hp|nph         TEPIDEIAALAEGSAVLAHDCSFPDGVDVDNHPTPSRLGETL--SGYDIGRVYLTHLYPH
12310|gene|hbo      SEAFEGLANFADGAAVLAHDCSFPDEVDVSNHPTPAQLGEAL--AGYDIGRVYLTHLYPH
1503|chp|nrc1       TEAFDGMGAFADGASVLVHDCSFPDEVDVSNHPTPTQLGASL--AGVDVDDLYLTHLYPH
                    : .   :   *:*: :*.******* .:.. *..*  *.  *      :. : *:**:**

2921|gene|hut       TDGRHEDMIASVHEH-YAGAVAVASDGLCVEV----------------------------
2927|gene|hwa       TEGNHETMRERIQKK-YDGEVRFARDGLTVTIDVGGDGDGSKNADDTTTE----------
10963|hp|hma        TEGRHEEMLESIADS-YDGDVQFAEDSLTITVS---------------------------
1591|gene|hhi       TEGRHEEMLESIADS-YDGDVQFAEDGLTITVDRT-------------------------
1860|gene|hla       TGGREREMAQSVRDAGFDGDVEVASDGLRVAIAERSGSAGDGSAAGAGEANEADEADEAD
4346|hp|nph         TDGHHEEMVAAVEDC-FDGDVRIANDGLTVSISGV-------------------------
12310|gene|hbo      TEGKHEEMLQSIGDR-YDGDVRFARDGLRIDI----------------------------
1503|chp|nrc1       TNGEHDAMTASIHEAGFDGEVHIARDGLGVEL----------------------------
                    * *    *   : .  : * * .* *.* : :                            

2921|gene|hut       --------------
2927|gene|hwa       --------------
10963|hp|hma        --------------
1591|gene|hhi       --------------
1860|gene|hla       ETDEADEAAEADGT
4346|hp|nph         --------------
12310|gene|hbo      --------------
1503|chp|nrc1       --------------