HOG Organism Gene ID Name Annotation
aHOG1702 hbo HBOR14690 Hbor_14690 hypothetical protein
aHOG1702 hla HLAC0302 Hlac_302 hypothetical protein
aHOG1702 hmu HMUK0134 Hmuk_0134 conserved hypothetical protein
aHOG1702 hma Hma_11942 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


14690|hp|hbo      -------MSAREEISFLVGSESRIAILRALQSSPSRPSELAAACSCARETAQRTVSAFAE
302|hp|hla        MAQTMTADDGHDGVQYLAGSPVRVAMLRALRSEPRRPASLTAAVDATRTTIQRILSGFRE
11942|hp|hma      MAEGLD-DTGFEDCQFLTGSPQRFAVLAQLRERPARPTDLCDTVDATRTTIQRILAGCTE
                           . :  .:*.**  *.*:*  *.. * **:.*  : ..:* * ** ::.  *

14690|hp|hbo      KGWVEKQPDSGTYALTAAGDVVADSYDEFETTVAVADSLSVLLSNLGTIVSDLDPTILHR
302|hp|hla        RDWVVKR--GAAYHVTPTGKRVHDAYEELLDEVELADRYGQFAADLERVGADFPPSALDT
11942|hp|hma      RQWVVKR--DGEYQLTVTGQRVFDQYNTLLSEIDQARTVGPLAAHLGAIAADLPPELLDP
                  . ** *.  .. * :* :*. * * *: :   :  *   . : : *  : :*: *  *  

14690|hp|hbo      LHGATATDDDPHAPINRFLTVVGDDYVDDFRGITPIVSRVFNQAAERVIGPDSNIELVID
302|hp|hla        GELTVAADRNPLAAVDRLTELLREGSGSEIRAVSPVVIQQFNNAAAEALDAGAEVELVID
11942|hp|hma      ECLTTSSEQNPLAAIDRFTDWLHEVNG-DVRAISPIVTSVFNDAAVELLETGTHIEFIID
                     :.::: :* *.::*:   : :    :.*.::*:*   **:**   : ..: :*::**

14690|hp|hbo      ERVYETSVSEYPDDLERAFELDQFQLFVSATRLDFGLMLVDNHAFLGAYDQHGNLIASVD
302|hp|hla        RDVVEESIAEFGPATDRALHDDGATVYVSPEPIEYGVFRYDDLACVTAYDSRNNPRCVLE
11942|hp|hma      HSVLERSASDFSDALDRGLEHENIDTYVHDTTLDIGLALDRSRVCLAAYDDRNNLRAIAE
                    * * * :::    :*.:  :    :*    :: *:    . . : ***...*  .  :

14690|hp|hbo      GTDEAFVEWAEQTYQQYRADADTPTAVEETTPESGVTHGSANDQ
302|hp|hla        STDSGVVDWVDDKFESFV---------AEAQCLSGVV---ENT-
11942|hp|hma      SDATAVYHWAETVFDRYR---------ERSQPLAAVLSVQEKN-
                  .   ..  *.:  :: :            :   :.*     :