HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0170COG0491KOG0813arCOG00505Zn-dependent hydrolases including glyoxylasesmetallo-beta-lactamase-related protein

HOG Organism Gene ID Name Annotation
cHOG0170 nrc1 VNG2073 mbl metallo-beta-lactamase-related protein
cHOG0170 hmu HMUK0740 Hmuk_0740 beta-lactamase domain protein( EC:3.1.2.6 )
cHOG0170 hma RRNAC2810 hypothetical protein
cHOG0170 hwa HQ3137A hydrolase ( hydroxyacylglutathione hydrolase)
cHOG0170 hla HLAC0007 Hlac_7 beta-lactamase domain protein
cHOG0170 hbo HBOR05170 Hbor_05170 Zn-dependent hydrolase, glyoxylase-like( EC:3.1.2.6 )
cHOG0170 hut HUTA1319 Huta_1319 beta-lactamase domain protein
cHOG0170 hvo HVO_1918 HVO_1918 metallo-beta-lactamase superfamily domain protein
cHOG0170 nph NP1688A hydrolase ( hydroxyacylglutathione hydrolase ) 4
cHOG0170 hhi 91 HAH_0091 beta-lactamase domain-containing protein
MUSCLE (3.6) multiple sequence alignment


7|gene|hla         ---------------------------MHAGEFESVR--GIADLYVHDTGMFGTDEYGAV
1688|gene|nph      ---------------------------MGIGDVRSVE--SVVDCYYVDTGMYGTDGYGAV
3137|gene|hwa      ---------------------------MDIGDIATVD--TADDIYYMDTGMYETPGYGSV
5170|gene|hbo      ---------------------------MAIGDVTAVP--GTDDVYYVDTGMYETEMYGSV
12810|hp|hma       MALPFLLPDCHDSHSITVLPPPVTRTCMGIGDVHEVTVGDCIDVHYVDVGMYGVAEYGPV
91|gene|hhi        ---------------------------MGIGDVYEVTVGDCTDVHYVDTGMYDVAEYGSV
2073|chp|nrc1      ---------------------------MSAGDVFDVS--GCPGISFVDTGMYDTAEYGSV
1319|gene|hut      ---------------------------MGIGDVRQVATGSCSDLWFVDTGMYAVSQYGSV
                                              *  *:.  *      .    *.**: .  **.*

7|gene|hla         YVYDTEKPAVIDTGTGVNREALFKTLDEIGIGREELAWILPTHAHLDHAGGAGHLVERYP
1688|gene|nph      YIYDTERPALVDTGIGTHYDRILDALDAVGIGRSELEYIIPTHAHLDHAGGAGFLVEETA
3137|gene|hwa      YIIDADQPAIVDTGIGTNYERIIDALGRVDIDTNSLAHLFVTHAHLDHAGGAGFLLADCP
5170|gene|hbo      YIIDAERPAFVDTGIGTNHEHLLDALDELDIAREDVEYLLPTHIHLDHAGGAGYLADACP
12810|hp|hma       YIIDAERPALVDTGTGARHETILSAMESVGIAPEDLEVIAATHVHLDHAGGAGYLAEDCP
91|gene|hhi        YIIDAERPALVDTGIGARHENILSAMESVGIAPEDLEVIAATHVHLDHAGGAGYLVEDCP
2073|chp|nrc1      YVIDADRPAVVDTGTGTNYERILDALEEHGIQPADLQAVLLTHVHLDHAGGAGLLAEACP
1319|gene|hut      YILDAERPAIVETGIGTHHDRILDALEEVGLAPEAIEVIAVTHVHLDHAGGAGFLAEACP
                   *: *::.**.::** *.. : ::.::   .:    :  :  ** ********* *    .

7|gene|hla         NAEVRLPEKGVRHLIDPEALVAGTKSAVQDQWQYYDDPAPVPEDRISGLAEGDRIDLGDR
1688|gene|nph      -ADVYTPEAAAQFLIDPSGLWEGTKRAVGEQIQFYTEPRPVPESRLEPLADGATLDLGDR
3137|gene|hwa      NATVHTHERAAPHLSDPTQLIEGTRAAVGEQWQYYVEPNPAPASRINALTDGDTVHLGDR
5170|gene|hbo      NATVMTHEIGVSHLIDPEKLIAGTKAAVGDQWEFYVEPKPVPEDRIEPLTDGNEIDLGDR
12810|hp|hma       NATVYVHESGKRHLVDPERLWEGTKHAVGDQIEFYGKPIPVAEDRIETLTDGDVIDLGDH
91|gene|hhi        NATVYVHESGKRHLADPQRLWEGTKHAVGDQIEYYGKPIPVPEDRIETLTDGDVIDLGDH
2073|chp|nrc1      NADVYVHELGARHVVDPERLVEGTKQAVGDQWQYYVEPTPVPEDRVVELTDGDTVDLGSR
1319|gene|hut      NASIVVHEIGAPHLAAPERLWAGTKQAVGDQITHYVEPEPVPEARIREIEDGDRIDLGDH
                    * :   * .  .:  *  *  **. ** :*  .* .* *..  *:  : :*  : **..

7|gene|hla         ELVVHEAPGHAPHHAFYHEPDADVVFTADAAGIYVPAVDTVRPTTPPPQFDLDQCLTDLS
1688|gene|nph      ELVLHDAPGHAFHQGILHEPDDAVVFAADAAGIYVPELDTVRETSPPADFDLEGVVEDAE
3137|gene|hwa      SLTAVAAPGHALHQMMFYDTTEDTLFTGDAAGIYIPMQDRIQQTSPPSQFNLETCLDDVR
5170|gene|hbo      TLSVFHAPGHAPHQTMFLDSKDDLLFTGDAAGIYVPERGQVRQTSPPSQFDLEACLDDVR
12810|hp|hma       SLETLHAPGHAPHQVVFYDPAIDGVFTADAAGIYNPSTDEMHVTTPPVNFTLDQALDDVA
91|gene|hhi        SLDVMHAPGHAPHQVVFYDPVVDGVFTADAAGIYTPATDEMHVTTPPVNFTLEGALDDVA
2073|chp|nrc1      TLTAHHAPGHTPHQVVFEDHSCDAVFTADAAGIWVRAQDRVRETSPPTDFDLEQCIDDVE
1319|gene|hut      ALRAHHAPGHAPHQVVYEDPANDAVFTGDAAGLYVPERGRVEPTSPPPDFDLEQALRDVE
                    *    ****: *: .  :     :*:.****::    . :  *:** :* *:  : *  

7|gene|hla         AIEEIDPEYLCFGHFGPREYEPS-LIGEAKRAYVEWVEAVREKREALGDDEAVVEHFEET
1688|gene|nph      LIADLDPETICYGHFGPAPAADR--IETYIAVITDWVESVEAARERLEDDEAVIEHFVEQ
3137|gene|hwa      AIDSMAPETLCFGHFGPRVYDDE-LLSSYKRALVEWVEAVRQKRGEANSDEDVIQYFSDN
5170|gene|hbo      TIEEIAPERICFGHFGSCEYSEE-LMESYKRTLVEWVEAVRQKREELGDDDAVIEHFAEH
12810|hp|hma       MIQDLDPDILMFGHFGAVETGDK--LETYTEILPEWVAEVERKREELDDDEAVIDYFV-E
91|gene|hhi        MLQDLDPDILMFGHYGPAETGDK--LETYAEILPEWVAEVERKREELGDDEAVIDYFV-K
2073|chp|nrc1      MIRRLDPETLLYAHFGPGPADTDAVLKEYEHVLRDWVAAVKREVIERHSEAAAIDHFAAT
1319|gene|hut      TIQAIDPETLLYSHFGPAMATGQ--LAEYARTLSDWVQAVAAARAELEDDDAVIEHFAGE
                    :  : *: : :.*:*.        :        :**  *        .:  .:::*   

7|gene|hla         SRDVEFWNPERARADASLNSRGILTYLNRIEGESEA
1688|gene|nph      STIDEVWGETKGRAEVAMNVRGVLQYLDSE------
3137|gene|hwa      AELIDVWGAEKARAEARLNVRGVLAYLDWQAAQTD-
5170|gene|hbo      TQMTDLWGERKASEEEKLNVRGVLGYLDWQAEQE--
12810|hp|hma       RADTDTWGERKGRAEMRLNVRGVLVALDNRDE----
91|gene|hhi        RADTDTWGERKGRAEMRLNVRGVLVALDNREE----
2073|chp|nrc1      TTVEDVWGEHKARAETKMNVRGVLRYLNTRA-----
1319|gene|hut      TAASDIWGPDKGRGETAMNVRGVLTYLDRTA-----
                       : *.  ..  :  :* **:*  *: