HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0017COG2873KOG0053arCOG00061O-acetylhomoserine sulfhydrylaseO-acetyl homoserine

HOG Organism Gene ID Name Annotation
cHOG0017 nrc1 VNG2421 hal O-acetyl homoserine
cHOG0017 hmu HMUK1096 Hmuk_1096 O-acetylhomoserine/O-acetylserine sulfhydrylase( EC:2.5.1.49 )
cHOG0017 hmu HMUK0819 Hmuk_0819 O-acetylhomoserine/O-acetylserine sulfhydrylase( EC:2.5.1.49 )
cHOG0017 hma RRNAC2716 cysD O-acetylhomoserine (thiol)-lyase
cHOG0017 hma RRNAC3063 metY O-acetylhomoserine (thiol)-lyase
cHOG0017 hwa HQ3454A metY O-acetylhomoserine aminocarboxypropyltransferase; methionine synthase
cHOG0017 hwa HQ3699A metY O-acetylhomoserine aminocarboxypropyltransferase (methionine synthase)
cHOG0017 hla HLAC2642 Hlac_2642 O-acetylhomoserine/O-acetylserine sulfhydrylase
cHOG0017 hla HLAC2551 Hlac_2551 O-acetylhomoserine/O-acetylserine sulfhydrylase
cHOG0017 hbo HBOR02470 Hbor_02470 O-acetylhomoserine sulfhydrolase( EC:2.5.1.49 )
cHOG0017 hut HUTA2621 Huta_2621 O-acetylhomoserine/O-acetylserine sulfhydrylase
cHOG0017 hut HUTA1608 Huta_1608 O-acetylhomoserine/O-acetylserine sulfhydrylase
cHOG0017 hvo HVO_2997 HVO_2997 thiol O-acetylhomoserine (thiol)-lyase
cHOG0017 nph NP0280A metY_2 O-acetylhomoserine aminocarboxypropyltransferase 2, methionine synthase
cHOG0017 nph NP0284A metY_1 O-acetylhomoserine aminocarboxypropyltransferase 1, methionine synthase
cHOG0017 hhi 319 metY2 O-acetylhomoserine (thiol)-lyase
cHOG0017 hhi 5 metY1 O-acetylhomoserine (thiol)-lyase
MUSCLE (3.6) multiple sequence alignment


2421|gene|nrc1      ---------------------MGHDHGLHTNSVHAGQ-RVDPATGARAPPLYQTTSYAFE
2642|gene|hla       -----------------MPADDDVDHEFRTRSVHAGS-SPDPATGARATPIYQTTSYEFE
280|gene|nph        ---------------------MFDRDDLYTDSLHAGQ-EADPTTGARAPPIYQTTSYEFD
12716|gene|hma      -------------------MSDDQDHGFETDALHVGQEEPDAEARSRAPPLYQTTSYVFE
5|gene|hhi          MAGLTGVAVIKTRPVEAGCMSDDQDHGFETDALHVGQEEPDAETRSRAPPLYQTTSYVFE
1608|gene|hut       --------------------MSDDDRGFHTDALHVGQEEPDPATGARAPPLYQTTSYVFE
3454|gene|hwa       ------------------MSDNESEPGFETRTLHAGQ-EPDPTTGARAPPLYQTTSYVFD
2470|gene|hbo       --------------MSEDADDDHGTPGFSTRSLHAGQ-DPDAATGARAPPIYQTTSYVFD
2621|gene|hut       -----------------MSGQESPSRQFGTRCLHAGQ-SPDPETGAVAPPIYQTTSYAFE
284|gene|nph        -----------MAICTAYMNDDERQLGFGTRCLHVGQ-GPDPETGAAAPPIYQTSSYEFP
13063|gene|hma      ---------------------MTDDYGFGTRCVHAGQEEPDPATGARAPPIYQTSSYVFE
319|gene|hhi        ---------------------MTNDYGFGTRCVHAGQEEPDPATGARAPPIYQTSSYVFE
3699|gene|hwa       -----------------------MTDGFKTRSLHAGQ-DPDETTGARAPPLHQTTSYVFE
2551|gene|hla       -----------------------MTRGFNTRSLHAGA-EADPATGSRATPIHQTTSFVFD
                                               : *  :*.*    *  : : *.*::**:*: * 

2421|gene|nrc1      DSADAAGQFALERD--GYIYSRLMNPTVETLQDRLAALEGGVGAVATASGMAALDLATFL
2642|gene|hla       NADHAARLFALEEA--GNVYSRIMNPTNAALEERIASLENGVGAVATSSGMAAFDLATFM
280|gene|nph        DAEHAADLFGLREA--GNIYSRIMNPTNAVLEERIASLEGGVAALATSSGMASFDLATFI
12716|gene|hma      DAEDAAKQFALEKP--GHIYSRLMNPTVGMLQERLAALEGGVGAVATASGMASLNLATFL
5|gene|hhi          DAEDAAKQFALEKP--GHIYSRLMNPTVGMLQERLAALEGGVGAVATASGMASLNLATFL
1608|gene|hut       DSEDAAAQFALEKE--GHIYSRLMNPTNSILQQRLAKLEGGVGAVATSSGMAALNLATFL
3454|gene|hwa       DADDAAQQFALEKE--GYIYSRLMNPTVATLQERLASLEGGIGAAATASGMAALDLATFL
2470|gene|hbo       DAEDAAGQFALEKE--GYIYSRLMNPTVATLQERLASLEGGVGAAATASGMAAFDLATFL
2621|gene|hut       DADRAADLYALEAE--GNVYSRFDNPTVRSLERRLASLESGVDAVATASGMAALDATTTA
284|gene|nph        DADTAAARYALEDE--GNVYSRVANPTVRALEERLASLEGGVDALATASGMGALDAATLV
13063|gene|hma      DADTAADRYALNDD--GNVYSRFDNPTVRMLENRIASLENAVDAVATGSGMAALDAGTFV
319|gene|hhi        DADTAADRYALEDD--GNVYSRFDNPTVRMLENRIASLENAVDAVATGSGMAALDAGTFV
3699|gene|hwa       DAETAADLYALAPDADGDVYSRISNPTVRTLEDRLAALEGGVAAVATASGMAALDAATSV
2551|gene|hla       DAETAAEMYALRAE--GHIYSRLSNPTVSVLEDRIADLSGGSDAVATGSGMAAFDAITTV
                    ::  **  :.*     * :***. ***   *: *:* *...  * **.***.:::  *  

2421|gene|nrc1      LARAGDSVVAASDLYGGTVTYLTHSAQRRGVDTTFVDVLDYDAYADAIDADTAYVLVETV
2642|gene|hla       LASAGDNIVSSSALYGGTYTYLTHSVERRGVSTRFVDPLDYEGYADAIDEDTAYVHLETI
280|gene|nph        LASAGDNIVSSSSLYGGTYTYLTHTVERRGVETRFVDTLDYEAYEEAIDEDTAFVHCETI
12716|gene|hma      LADVGDNVVTASSLYGGTYTYYTHTAPRNGVETRFVDTLDYDAYAEAIDENTAYVHCETI
5|gene|hhi          LADVGDNVVTASSLYGGTYTYYTHTAPRNGVETRFVDTLDYDAYAEAIDENTAYVHCETI
1608|gene|hut       LADVGDNVVTASALYGGTYTYYTHTAPRQGVEARFVDTLDYDAYEEAIDEDTAYVHFETI
3454|gene|hwa       LASAGDNIVTASSLYGGTYTYFTHTVERRGVSARFVDTLAYDEYAEAIDDDTAYVHIETI
2470|gene|hbo       LASAGDNIVSASSLYGGTYTYLTHTVERRGITTKFVDTLDYDAYDEAIDEDTAFVHVETI
2621|gene|hut       LASAGENIVSAASIYGGTHSYLTTTARERGIEARFVDTLDYGAYAATIDDETAYVHLETI
284|gene|nph        LAEAGDNIVSASSIYGGTHAYLSHTAARRGIESRFVETLDPAAYEEAIDEDTAYVHCETI
13063|gene|hma      LAANGDNIVTASSIYGGTHSYYSNTASRRGIETRFVDTLDPDAYAEAIDEDTAYVHFETI
319|gene|hhi        LAANGDNIVTASSIYGGTHSYFSKAASRRGIETRFVDTLDPDAYAAAIDEDTAYVHFETI
3699|gene|hwa       LARAGNNIVVAADMYGGTATYFRQMATRRGITIRTVDTLAYDEYTEEIDSETAFVHVETI
2551|gene|hla       LASAGDNVVASSEMYGGTAAYLTSIANRRGVEARLVDTLDDEAYADAIDDDTAFVHVETV
                    **  *:.:* :: :**** :*    .  .*:    *: *    *   ** :**:*  **:

2421|gene|nrc1      GNPSLITPDLERIADIAHDNGVPLLVDNTFATPALATPIDHGADIVWHSTTKWIHGAGTT
2642|gene|hla       GNPALVTPDIERIADIAHDHGVPLFVDNTFATPYLCRPLDHGADLVWESTTKWLTGNGTT
280|gene|nph        GNPALVTPDLERLADIAHDNGVPLFVDNTFATPALCRPLEHGADLVWNSTTKWIHGSGTT
12716|gene|hma      GNPSLVTPDFERLAEIAHDHGVPFFVDNTFATPYLCNPIEHGADLVWNSTTKWIHGHGTT
5|gene|hhi          GNPSLVTPDFERLAEIAHDHGVPFFVDNTFATPYLCNPIEHGADLVWNSTTKWIHGHGTT
1608|gene|hut       GNPALVTPDIERIADIAHDHGVPLLVDNTFATPYLCNPIEHGADLVWNSTTKWIHGSGTT
3454|gene|hwa       GNPALVTPDIERIADIAHEHDTPLFVDNTFATPALCRPIEHGADLVWDSTTKWIHGAGTT
2470|gene|hbo       GNPALVTPDFERLADIAHDHGVPLFVDNTFATPYLCQPLEHGADLVWESTTKWIHGAGTT
2621|gene|hut       GNPSLVTPDIERIADIAHDHGAPLVVDNTFATPYLCNPIEHGADVVWESTTKWIHGSGTT
284|gene|nph        GNPALVTPPLSEIAAVAHDNGVPLFVDNTFATPALCRPLEHGADLVWDSTTKWIHGSGTT
13063|gene|hma      GNPSLVVPPMEEIAEVAHDHGVPVFVDNTFGTPALCNPLDHGVDLLWESTTKWIHGSGTT
319|gene|hhi        GNPSLVVPPMEDIAEVAHDHGVPVFVDNTFGTPALCNPLDHGVDLLWESTTKWIHGSGTT
3699|gene|hwa       ANPSLKTPDIERIADIAHNAETPLVVDNTFATPALSRPIEYGADIIWESTTKWLHGSGTT
2551|gene|hla       ANPSLVTPDFERLAEIAHENAVPLVVDNTFATPYLCRPFEHGADIVWESTTKWITGNGTT
                    .**:* .* :. :* :**:  .*..*****.** *. *:::*.*::* *****: * ***

2421|gene|nrc1      VGGALVDAGSFDWDAHAADYPEIAQENPAYHGVTFTDRFGDAAFTYAAIARGLRDLGNQQ
2642|gene|hla       VGGVLVDGGSFPWSEYAEKYPEIAQDNPAYHGINYVEAFGDAAFTFAAVTRGLRDLGDQQ
280|gene|nph        VGGVLVDGGSFPWDEHADRFPEIAKPNPAYHGINFSETFGDAAFAYAARTRGLRDLGNQQ
12716|gene|hma      VGGVLVDGGSFPWEEHADKYPEIAGDNPAYHGVNFRERFEDAAFTYAAIARGLRDLGCQQ
5|gene|hhi          VGGVLVDGGSFPWEEHADKYPEIAGDNPAYHGVNFRERFDDAAFTYAAIARGLRDLGCQQ
1608|gene|hut       VGGILVDGGSFPWDEYAEDYPEVAGDNPAYHGVNFEERFGDAAFTYAAIARGLRDLGNQQ
3454|gene|hwa       VGGVLIDGGSFPWGEHPEKYPEIGASNPAYHGVNFAERFGDAALTYAAIARGLRDLGNAQ
2470|gene|hbo       IGGILVDGGSFPWTDYADKYPEIAKPNSAYHGVNFAERFGDAAFTYAAIARGLRDLGNQQ
2621|gene|hut       VGGVVIDGGSFPWADHPEKYPALGESAGALDDESFVDRFGERAFAVATRQRAVRNVGDGQ
284|gene|nph        LGGILVTDGSFPFEEYPEKYPEIAAPNPAFDGTVFAERFGDRAVTMAARHRATRSIGDPQ
13063|gene|hma      VGGVLVDGGSFPWDEYPEKFPELGGENEAF-GKNFSEAFGDRAFSVAARQRALRSLGDGQ
319|gene|hhi        VGGVLVDGGSFPWDEYPEKFPELGGENEAF-GKNFTEAFGDRAFSVAARQRALRSLGDGQ
3699|gene|hwa       VGGILVDGGTFPWEH--ADYDELSGENPTF-GIDFVDRYGAAAFAHVARQRALRTLGNQQ
2551|gene|hla       VGGIVVDGGQFPWDHPDADYDELDGQSPAY-PIDFVERFGDAAFGNVARQRGVRPTGGQQ
                    :** ::  * * :      :  :     :     : : :   *.  .:  *. *  *  *

2421|gene|nrc1      SPFDAWQTLQKLETLPLRMQQHCRNAQLVAEHLRDHPNVSWVNYPGLADHDTHDNATTYL
2642|gene|hla       SPFDAWNTLQQTESLPLRMERHCENAGIVAEYLDEHDDVAWVNYPGLESHETHDEASEYL
280|gene|nph        SPFDAWTTVQGLETLPMRMERHCENAQAVAEFLDDHPEVSWVTYPGLEDHETHEEASEYL
12716|gene|hma      SPFDAWQTMQGLETLPARMDRHCDNAMGVAEFLADHPEVSWVTYPGLEDHETHDTASKYL
5|gene|hhi          SPFDAWQTMQGLETLPARMDRHCDNAIGVAEFLADHPEVSWVTYPGLEDHETHDTASEYL
1608|gene|hut       APFDAWQTIQGLESLPMRMERHSENALAVAEYLEAHQDVAWVNYPGLESHETHEEASKYL
3454|gene|hwa       SPFDAWNTLEKLESLPMRMEQHCTNAMAVAEFLDSHEAVSWVNYPGLTDHETHAEATSYL
2470|gene|hbo       SPFDAWNTLEKVESLPMRMERHCENAQVVAEFLESHDEVSWVNYPGLESHETHEEASKYL
2621|gene|hut       KPFDAWATLQGAETLAVRMERHCENATRVAEFLADHPAVEWVSYPGLESHETNEQASEYL
284|gene|nph        SPFDAWATLQGSETLSLRMERHCENARAVAEFLADHPKVSWVTYPGLEAHETHDLANEYL
13063|gene|hma      KPFDAWATLQGAETLSLRMERHCENAMAVARHLEDHPEVAWVTYPGLESHETHDLAQQYL
319|gene|hhi        KPFDAWATLQGVETLSLRMERHCENAMTVAQHLDDHPDVAWVTYPGLESHETHDLAQQYL
3699|gene|hwa       SPFDAWQTLQGLETLPLRMERHCANAKTVGIFLRNHNDVAWVSYPGFEDHPTHDKATQYL
2551|gene|hla       SPFDAWQTIQGLNTLPLRMERHCENARTVAEFLQDDDRVDWVTYPGFEDHQSHDNAAKYL
                     ***** *::  ::*. **:.*. **  *. .*     * **.***:  * ::  *  **

2421|gene|nrc1      -----DSGYGGMLTFGVEDGYEAAQSVTEETTLASLLANVGDAKTLVIHPASTTHQQLTP
2642|gene|hla       -----EGGYGGMITFGLEGGYEAAKGTVENADLASLLANVGDAKTLVIHPASTTHQQLTE
280|gene|nph        -----DG-YGGMITFGLEDGYEAARTTVESTELASLLANVGDAKTLIIHPASTTHQQLTD
12716|gene|hma      -----DGGYGGMITFGLDAGYDAARTTVESTEIASLLANVGDAKTLIIHPASTTHQQLTD
5|gene|hhi          -----DGGYGGMITFGLDAGYDAARTTVESTEIASLLANVGDAKTLIIHPASTTHQQLTD
1608|gene|hut       -----DGGYGGMITFGLDAGYEAARDTVESTELASLLANVGDAKTLIIHPASTTHQQLSD
3454|gene|hwa       -----KGGYGGMITFGLDAGYEAARDTVNNVELASLLANVGDAKTLVIHPASTTHQQLTE
2470|gene|hbo       -----DGGYGGMITFGLEAGYDAARETVNHVELASLLANVGDAKTLVIHPASTTHQQLTE
2621|gene|hut       -----QGGFGGMVTFGLSGGYEGAKRLCEETDLAQFLANVGDAKTLIIHPASTTHAKLSP
284|gene|nph        -----DGGYGGMVAFGPEGGYEAGKRLCEDTEVAKFLANIGDARTLVIHPASTTHAQLTG
13063|gene|hma      -----SGGFGGIVTFGLEAGYDAGRRFCEETDLAQFLANIGDAKTLVIHPASTTHAQLSE
319|gene|hhi        -----SGGFGGIVTFGLEGGYDAGRRFCEETELAQFLANIGDAKTLVIHPASTTHAQLSE
3699|gene|hwa       GTDIVESGYGGMLTFGLEGGFEVAKRTCEETSVISFLANVGDAKTLIIHPASTTHAQLSA
2551|gene|hla       -----DG-YGGMVTFGVDGGYEAAKTFCEAVDLTSFLANIGDAKTLVIHPASTTHAQMDE
                         .. :**:::** . *:: ..   : . : .:***:***.**:******** ::  

2421|gene|nrc1      EAQRAGGVRPEMVRVSVGIEDPADIVADLETAIEAAVGSA--------------------
2642|gene|hla       EEQEAAGVTGDMVRLSVGIEDPADIVADLEAAIERASA----------------------
280|gene|nph        EEKQASGVTDDLVRLSVGLEDTDSIIADLEAAIDEAT-----------------------
12716|gene|hma      EEKAAAGVTDDMVRLSVGTESVEDIKADLDQAIGQATN----------------------
5|gene|hhi          EEKAAAGVTDDMVRLSVGTESVEDIKADLDQAIGQATN----------------------
1608|gene|hut       DEKAAAGVTDDMVRLSVGVEDPDDIIDDLDQAITWATR----------------------
3454|gene|hwa       SEQEAAGVTPDMVRLSVGIENVDDIIADLTQAIDTATA----------------------
2470|gene|hbo       EEQVAAGVTPDMVRLSVGVEDADDIVADLQQAIETATN----------------------
2621|gene|hut       EEQRASGVAPDMIRLSVGIEDVRDIIGDLKEGIETAT-----------------------
284|gene|nph        EEQRASGVTPDMIRLSVGIEDVDDIIADLDATL---------------------------
13063|gene|hma      AEQRASGVTPDLLRFSVGIEDPEDIIADIDEAIERVT-----------------------
319|gene|hhi        EEQRASGVTPDLLRFSVGIEEPEDIIADIDDTIERIT-----------------------
3699|gene|hwa       EEQQAAGLTPDMLRLSVGLEDPDDIIDDLNQAIHSATMQSEDYTRREGTHTNLAHTTDNR
2551|gene|hla       TQQRLAGVYPEMLRLSVGIEDADDVIADLDQGLTAGERAA--------------------
                      :  .*:  :::*.*** *.  .:  *:   :                           

2421|gene|nrc1      ------------------
2642|gene|hla       ------------------
280|gene|nph        ------------------
12716|gene|hma      ------------------
5|gene|hhi          ------------------
1608|gene|hut       ------------------
3454|gene|hwa       ------------------
2470|gene|hbo       ------------------
2621|gene|hut       ------------------
284|gene|nph        ------------------
13063|gene|hma      ------------------
319|gene|hhi        ------------------
3699|gene|hwa       TDSDSNTRQTDTEVASSE
2551|gene|hla       ---------TDTEV----