HOG Organism Gene ID Name Annotation
aHOG1697 hbo HBOR11690 Hbor_11690 predicted dehydrogenase
aHOG1697 hla HLAC1619 Hlac_1619 oxidoreductase domain protein
aHOG1697 hmu HMUK2258 Hmuk_2258 oxidoreductase domain protein
aHOG1697 hma Hma_10268 yrbE oxidoreductase
MUSCLE (3.6) multiple sequence alignment


10268|gene|hma      MSVISAPSEQPAMTLDIGMLGYRFMGKAHANALDRLPMFFPEAPAVNKDVLVGRDEDALA
11690|hp|hbo        ------------MTLNVAVLGYRFMGKAHSNALARLPMFFPDAPDVHRHTLIGRDEEALA
1619|gene|hla       ---------MTQQPLRIGVLGYRFMGKAHANALARLPMFFPDAPDIERHTLVGRDEEALA
                                 .* :.:**********:*** *******:** : . .*:****:***

10268|gene|hma      DAADQFDFDRTATDWRAIVDEVDVFYNLGPNHVHAEPSIAALEAGTPTFCEKPLAPTLDT
11690|hp|hbo        SAADELGFEHTATDWESVVDEVDAFYNLGPNHIHAEPSIAALKADTPVFCEKPLAPTLDE
1619|gene|hla       DAAERFGFSHTATDWEDSLDEVDVFYNLGPNHVHAEPSIAALEAGVPVLCEKPLAPTLDE
                    .**: :.*..*****   :****.********:*********:*..*.:********** 

10268|gene|hma      AEEMAEAAADADVPAGAAFNYRFVPAIQYAKGLIDDGVLGEIHHFRGQYLQDWLVDPEAP
11690|hp|hbo        AEKMRDAAADSDAIAGCAFNYRFVPAIQYAKGLIDDGTLGEIRHVRGSYMQDWLTDADAP
1619|gene|hla       AAAMRDAAADADVPAGTAFNYRFIPAIRYAKGLIEDGELGEIRQVRGRYLQDWLVDPEAP
                    *  * :****:*. ** ******:***.******:** ****.:.** *:****.*.:**

10268|gene|hma      WSWRNDEEMAGSGALGDLGSHTVDLARFLLGDAAGEITDVSGHLRTFTEERPV----EGS
11690|hp|hbo        WSWRNDAKLAGSGALGDLGAHTIDLARFLVGDVAGDIERISGNLQTFVAERPV----EGT
1619|gene|hla       WAWRMDADTAGSGALGDLGAHTLDLADFLVGDEVGEIDRVSGHLQTFVDERPVYDEAGDV
                    *:** * . **********:**:*** **:** .*:*  :**:*.**. ****     . 

10268|gene|hma      DETRPVTVDDAYSAQIVFDSGAMGTLEASRVANGHKNAHTIEIEGSKGAVKFDLERLNEL
11690|hp|hbo        DETRPVTVDDAYSAQATFENGAMGTFEASRVADGHKNDHTIRIHGSEGSLRFSLERLNEL
1619|gene|hla       EEYRDVTVDDAYTAQVAYESGAMGSFEATRFAEGHKNDHAIEIHGSKGSLKFSLERLNEL
                    :* * *******:** .::.****::**:*.*:**** *:* * **:*::.*.*******

10268|gene|hma      QVLTEGDRGFQQVLVTDEDDPYVDHWWPPGHVIGWEHTFVHENYEFLSAVADGRQQEPSF
11690|hp|hbo        EYKGADHRGYETILMTDADDPYLDHWWPPGHVLGWEHTFVHENYEFLSAIRDGVAFSPSF
1619|gene|hla       EVLREDDRGYQTVLVTDETDPYVDHWWPPGHVIGWEHTFVHENYEFLSAVAEGGEFEPSF
                    :    . **:: :*:**  ***:*********:****************: :*   .***

10268|gene|hma      ADGLAAQRVLDAIEQSDDRGERVSL-
11690|hp|hbo        EAGYAVQQILDAIERSDDSGEWVSL-
1619|gene|hla       EQGYKVQKLLDAVERADERGEWVSVE
                      *  .*.:***:*.:*: **.**: