HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0169COG0519arCOG00085GMP synthase PP-ATPase domain/subunitGMP synthase subunit B

HOG Organism Gene ID Name Annotation
cHOG0169 nrc1 VNG1829 guaAb GMP synthase subunit B
cHOG0169 hmu HMUK1394 Hmuk_1394 GMP synthase, large subunit( EC:6.3.5.2 )
cHOG0169 hma RRNAC3472 guaA1 GMP synthase subunit B
cHOG0169 hwa HQ3194A guaAb GMP synthase subunit B
cHOG0169 hla HLAC2593 Hlac_2593 GMP synthase, large subunit
cHOG0169 hbo HBOR09490 Hbor_09490 GMP synthase (glutamine-hydrolyzing)( EC:6.3.5.2 )
cHOG0169 hut HUTA0426 Huta_0426 GMP synthase, large subunit
cHOG0169 hvo HVO_2625 HVO_2625 guaA GMP synthase C-terminal domain
cHOG0169 nph NP1970A guaAb GMP synthase subunit B
cHOG0169 hhi 695 guaA2 GMP synthase subunit B
MUSCLE (3.6) multiple sequence alignment


3194|gene|hwa       MVDVSVFIDEAIAEIDAAIGEDNAVIALSGGVDSSVSAALAYKAIGDQLTPVYVDTGLMR
1829|gene|nrc1      MVDVDSFVEDARAEISEALGDETAIIALSGGVDSSTAAALAYEAVGDQLVPVYVDTGLMR
9490|gene|hbo       MVNTDSFIEEATEEIQETVGDANAIIALSGGVDSSVAAALAYRAIGDQLTPVYVDTGLMR
2593|gene|hla       MVETEEFIAEAKAEIREAIGDANAVIALSGGVDSSVAATLAYEAVGDQLTPVYVDTGLMR
1970|gene|nph       MVEPTAFIDEKIAEIADDVGDANAVIALSGGVDSSTAAALAYEAIGDQLTPVYVDTGLMR
426|gene|hut        MVDVETFIPEAKAEIDAQIGDSKAVIALSGGVDSSTAAALAYDAIGDQLTPVYVDTGLMR
13472|gene|hma      MVNVDEFIEEAKAEIAEEIGDKHAVIGLSGGVDSSTAAALAYEAIGDQLTAVYVDTGLMR
695|gene|hhi        MVNVDEFIADAKAEIADEIGDKNAVIALSGGVDSSTAAALAYEAIGDQLTPVYVDTGLMR
                    **:   *: :   **   :*:  *:*.********.:*:*** *:****..*********

3194|gene|hwa       KGETKQVKDTFAYMDSLRVVDAQDRFFESLAGVTDPEEKRHVIGEQFIREFEEEAHAANA
1829|gene|nrc1      KGETDEIREVFDYMDSLRVVDASDRFFDELAGVTDPEEKRHAIGEQFIREFETVAEEVDA
9490|gene|hbo       KGETEGIRETFDYMESLRVVEAQDRFLGALEGVIDPEEKRKVIGEQFIREFEREAKDTDA
2593|gene|hla       KGETEEIRETFSFMESLRVIEAQERFFDRLAGVTDPEEKRHVIGEGFIDEFETVANDVGA
1970|gene|nph       KGETDQIRDTFDYMDSLRIIDARDRFLDALSGITDPEEKRHAIGEQFIREFETVARDVDA
426|gene|hut        KGETEQIRETFDYMDSLRIVDATDRFLDELEGVTDPEEKRHAIGEQFIREFETVAREVDA
13472|gene|hma      KGETDEIRETFDYMDSLRIVEAQDRFLDELEGETDPEEKRHIIGEQFIREFETVAREVDA
695|gene|hhi        KGETDQIRETFSYMDSLRIVDAQDRFLDALGDETDPEEKRHIIGEQFIREFETVAKDVDA
                    ****. :.:.* :*:***:::* :**:  * .  ******: *** ** ***  *  ..*

3194|gene|hwa       DYLVQGTIYPDRIESEGNIKSHHNVGGLPDVVDFEGIVEPVRELYKDEVREVARELDLDE
1829|gene|nrc1      TQLVQGTIYPDRIESEGTIKSHHNVGGLPERVGFEGIVEPMRDLYKDEVREVARHLGLEE
9490|gene|hbo       NYLVQGTIYPDRIESEGNIKSHHNVGGLPDVVDFEGIVEPVRDLYKDEVREVARELGLES
2593|gene|hla       DYLVQGTIYPDRIESEGNIKSHHNVGGLPDIVDFEGIVEPVRDLYKDEVREVARALGLEE
1970|gene|nph       DYLVQGTIYPDRIESEGTIKSHHNVGGLPEVVDFEGIVEPMRDLYKDEVREVARELDLES
426|gene|hut        DYLVQGTIYPDRIESEGTIKSHHNVGGLPDVVDFDGIVEPMRDLYKDEVREVARELDLEE
13472|gene|hma      DYLVQGTIYPDRIESEGTIKSHHNVGGLPERIDFDGIVEPMRDLYKDEVREVARALDLEE
695|gene|hhi        DYLVQGTIYPDRIESEGTIKSHHNVGGLPEVVDFEGIVEPMRDLYKDEVREVARALDLEE
                      ***************.***********: :.*:*****:*:*********** *.*:.

3194|gene|hwa       LVSERMPFPGPGLAIRVIDEVTREKVAVAREACHIVESETAEFDPWQAFAAVVGKATGVK
1829|gene|nrc1      IISERMPFPGPGLAVRVIGEVTPEKVAVCREATHIVEDELEAYEPWQAFAAVLGRATGVK
9490|gene|hbo       VVSERMPFPGPGLAVRIVGEVTEEKVEVARHACHVVEEELEEYDPWQAFAAVIGKGTGVK
2593|gene|hla       VISERMPFPGPGLAVRIVGEVTPEKAAVAREATHVVEEELEEYDPWQAFAAVLGKATGVK
1970|gene|nph       IIAERMPFPGPGLAIRVLGEVTDEKLAVAREANHVVEEELEEYEPWQALAAVLGKATGVK
426|gene|hut        IISERMPFPGPGLAVRIIGEVTAEKLDVAREANHVVEEELEEYEPWQALAAVIGKATGVK
13472|gene|hma      IISERMPFPGPGLAVRIIGEVTEEKLAVAREANHVVEEELEEYEPWQALAAVIGKATGVK
695|gene|hhi        IISERMPFPGPGLAVRIIGEVTEEKLEVAREANHVVEEELEEYEPWQALAAVIGKATGVK
                    :::***********:*::.*** **  *.* * *:**.*   ::****:***:*..****

3194|gene|hwa       GDNRVHGWIVSVRAVESRDGMTARAQELPWEALQRIQSRITGENDDVARVLYDITHKPPA
1829|gene|nrc1      GDNRVHGHVVAVRSVESRDGMTARAQELEWETLQRLQSRIAGTIDEVSRVVYDVTHKPPA
9490|gene|hbo       GDNRVHGWIVSVRSVESRDGMTARAQELSWETLQRIQSRITGQNDNVARVVYDVTHKPPA
2593|gene|hla       GDNRVHGWVVAVRSVESRDGMTARAQELDWSTLQRIQSRITGENENVARVVYDVTHKPPA
1970|gene|nph       GDNRVHGWVVSVRSVESRDGMTARAQELDWETLQRIQSRITGENENVARVVYDVTHKPPA
426|gene|hut        GDNRVHGWVVAVRSVESRDGMTARAQEIDWETLQRIQSRITGENENVSRVVYDVTHKPPA
13472|gene|hma      GDNRVHGWVVAVRSVESRDGMTARAQELDWDTLQRMQSRITGAHENVARVVYDVTHKPPA
695|gene|hhi        GDNRVHGWVVAVRSVESRDGMTARAQELDWDTLQRIQSRITGAHENVARVVYDVTHKPPA
                    *******.:*:**:*************: *.:***:****:*  ::*:**:**:******

3194|gene|hwa       TIEYE
1829|gene|nrc1      TIEYE
9490|gene|hbo       TIEYE
2593|gene|hla       TIEYE
1970|gene|nph       TIEYE
426|gene|hut        TIEYE
13472|gene|hma      TIEYE
695|gene|hhi        TIEYE
                    *****