HOG Organism Gene ID Name Annotation
aHOG1685 hbo HBOR15400 Hbor_15400 hypothetical protein
aHOG1685 hla HLAC0313 Hlac_313 hypothetical protein
aHOG1685 hla HLAC0909 Hlac_909 hypothetical protein
aHOG1685 hmu HMUK2103 Hmuk_2103 conserved hypothetical protein
aHOG1685 hma Hma_11293 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


15400|hp|hbo      --------------MTTRRIVAAVLAVAILTTTTGCIGFLTGE-ESLSFAAKPAVVDESA
909|hp|hla        ---------------MHRRGLLAAIAASTSVAVAGCAG---GENGSYEFDAEPASVPSSA
313|hp|hla        MTREPTADEMTDIDALTRRRALTAAGGAALAGLAGCTALDVATGEPAEFTAGTATVADAA
11293|hp|hma      ----------------MRKGILTLLVG-VLVVSSGCTGLITGE--TVAFDSAPATVSDSA
                                   *.   :       .  :** .   .   .  * : .* * .:*

15400|hp|hbo      AESAGYATDGPQTVEVNETVTVAGQERHVVAKNQVTTYEKTLDL-TIFEAKLGMFTVISS
909|hp|hla        ASEAGYEGEEPKPFTIEQEFDVAGVNAQVSATTWAAGYENS--------ENGSALFVAST
313|hp|hla        LDESGYELNEVTENTQTREFDVAGSTREVRVTSTIAEYDKAVEL-FGERYQAAVFAVLTT
11293|hp|hma      LDETGYEQSMADEQTIERTVTVAGQERTIRVTNHVRQYQRGIDLGPVGEVNAGRFIVFST
                   ..:**  .          . ***    : ...    *:.          : . : * ::

15400|hp|hbo      PAVEVAGQTMNPISDYSSRQLVGLVETQYQG-----------LSDVNKVSSQTITVQGQE
909|hp|hla        PNASVGGQSVNPLVRADDAELIRRLLEQVDQRGIGGEGTDIEASNIENRGSETRTILGEE
313|hp|hla        PRVEVLGQAFNPVGELDDEERARLIVDRYES-----------VSNLERSSEYTTDILGTD
11293|hp|hma      PSASVAGQTLNPAASWSNERLVEEVASRNDQ-----------INDVQFERNRTVEALGES
                  * ..* **:.**    ..      :  . :             .:::   . *    * .

15400|hp|hbo      TEVTKF--AAKATINGER--------VDVYVHVM-KYKDGEDFIVGLGLYPQKLDSEENN
909|hp|hla        VEISILETTIDAEVDGGGGESGTVEDVPVYLYVG-TVQHGEDVIALVGVHPTAVDASESL
313|hp|hla        ARVVVY--TADGEIKGTG------VSVELEFHVAEAVEAGADYVVPLAAYPAAFGDGENV
11293|hp|hma      REVAVF--SGTTTIEGQS--------VDVLIHLT-SFEHEGDVVVAVAVYPERLDDSEGP
                    :     :    :.*          * : .::    :   * :. :. :*  ..  *. 

15400|hp|hbo      IM-SMMRAIEHPAEANGTTEQAA
909|hp|hla        L--SLMEQVEH------------
313|hp|hla        R--RMLNGIEHEPASEDD-----
11293|hp|hma      RVDTLLGGLSHSGN---------
                      ::  :.*