HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0168COG0389KOG2095 KOG2094arCOG04582Nucleotidyltransferase/DNA polymerase involved in DNA repairDNA damage bypass polymerase

HOG Organism Gene ID Name Annotation
cHOG0168 nrc1 VNG1014 umuC DNA damage bypass polymerase
cHOG0168 hmu HMUK2368 Hmuk_2368 DNA-directed DNA polymerase( EC:2.7.7.7 )
cHOG0168 hma RRNAC0540 dinB DNA polymerase IV
cHOG0168 hwa HQ3359A polIVy DNA polymerase IV
cHOG0168 hla HLAC2466 Hlac_2466 UMUC domain protein DNA-repair protein
cHOG0168 hbo HBOR19230 Hbor_19230 nucleotidyltransferase/DNA polymerase involved in DNA repair( EC:2.7.7.7 )
cHOG0168 hut HUTA2776 Huta_2776 DNA-directed DNA polymerase
cHOG0168 hvo HVO_1302 HVO_1302 dinP DNA polymerase IV (DNA damage bypass polymerase)
cHOG0168 nph NP2918A DNA polymerase IV
cHOG0168 hhi 1102 dinB DNA polymerase IV
MUSCLE (3.6) multiple sequence alignment


2918|gene|nph       ---------------------------------------MPQLPGV----DPRRQ-VVCH
2776|gene|hut       ------------------------------------MSRPGRLPVE----STREDRIVCH
10540|gene|hma      -------------------------------------MDAARLPGT----SGPEQ-IVAH
1102|gene|hhi       -------------------------------------MDAARLPGT----SGPEQ-IVAH
1014|gene|nrc1      MINGRNAWLLAGTRGVHAGGGRAVRSLFRADGEPPVMPAGERLPGA----PAREERIVVH
3359|gene|hwa       -------------------------------------MRGETLPGTDNSTNTPDQ-IILH
2466|gene|hla       -------------------------------------MAGGTLPGTDADDDAGSDRIVFH
19230|gene|hbo      -------------------------------------MAGETLPGV-TRKERADARIVLH
1302|gene|hvo       --------------------------------------VEETLPGT-ADDDGPDS-IVLH
                                                              **            :: *

2918|gene|nph       VDVDCFYAACERLREPKLRDEPVVVGMGYEPGADHGAVATASYEAREHGVESAMAISEAL
2776|gene|hut       VDMDCFYAACERLREPALRDEPVIVGMGYEPGETSGAVATASYEAREHGVESAQSIEQAL
10540|gene|hma      VDMDCFYAACEQRREPALRNEPLVVGMGYENGATHGAVATASYEARAYGVESAMAISEAL
1102|gene|hhi       VDMDCFYAACEQRREPALRGEPLVVGMGYENGATHGAVATASYEARAYGVESAMAISEAL
1014|gene|nrc1      VDMDCFYASCERRREPALRGAPVVVGMGYEPDQTVGAVATASYEAREYGVESAQAISAAL
3359|gene|hwa       VDMDCFYASCERLREPALRDVPVVIGMGYEPGETFGAVATASYEAREYGIESAQPISHAL
2466|gene|hla       VDMDCFYASCERLRRPELADEPLVVGMGYEAGEAIGAVATASYEARAFGVESAMPISEAL
19230|gene|hbo      VDMDCFYASCERLREPELRGEPVVVGMGYEAGESFGAVATASYEAREYGIDSAQPISQAL
1302|gene|hvo       VDMDCFYAACERLREPELEGEPVVVGMGYEPGEGHGAVATASYEAREFGVDSAQPISTAL
                    **:*****:**. * * * . *:::***** .   *********** .*::** .*. **

2918|gene|nph       KRLPQR--------TDSESGEAGTGYYRPVDMAYYESVSEDVQAVLDDTAETVRNVSIDE
2776|gene|hut       ELLPRR--------ETADPDAEPTAYYRPVDMPYYEDVSEQVRSILAEYADVLRAVSIDE
10540|gene|hma      ERLPRKVKAV----ADPDLTVEDAGFYRPVDMDFYESVAADVREILHTEADVVREVSIDE
1102|gene|hhi       ERLPRKVDAV----DDPALDVEDAGFYRPVEMDFYESVAADVRDILHAEAAVVREVSIDE
1014|gene|nrc1      ERLPR---------KADAPDASAAGYYRPVDMAYYESVSESVSEILHGLGDPVREVSIDE
3359|gene|hwa       ERLPRADVDEPNGADDTDTESNPSGYYRSVDLDFYQSVAAEVKDILHDCADVVREVSIDE
2466|gene|hla       DLLPRRVNADPD--DPDAPDPDEAGRYLPVDLDFYKEVASDVKTVLRDCADVLREVSVDE
19230|gene|hbo      ERLPQ---------IENAADDEPGGHYRPVDMEFYKSVASEVKEILHDCADVVREVSIDE
1302|gene|hvo       ERLPRIDD------LGPGDDPAAAGHYRTVDLEFYKSVAADVKAILHDCADVVREVSIDE
                    . **.                   . * .*:: :*:.*: .*  :*   .  :* **:**

2918|gene|nph       AYLDLGD-LAWDD----------------AEAFGRQLKADIEAAAGVVASVGIAPTMATA
2776|gene|hut       AYLDVTDRTDWES----------------VETFATELKDEIAETVGVEASVGVAPTMSAA
10540|gene|hma      AYLDVTERVSWET----------------VMSWAQDLKDTIESAVGVVASVGVAPTMSAA
1102|gene|hhi       AYLDVTEQVSWET----------------VESWAQDLKDTIESEVGVAASVGVAPTMSAA
1014|gene|nrc1      AYLDVTDRTAWDV----------------AAGFGRHIKQRIARSVGVPASVGIAPDMSTA
3359|gene|hwa       AYLDITDRTAWQQTESGD--------RTLAEGYARYVKQRIMRTVGVPASVGVAPNMSAA
2466|gene|hla       AYLDVTDRTAWDAAGGESTATGPAETRTLAEGYARHIKERIEREAGVPASVGVAPNMSTA
19230|gene|hbo      AYLDVTDRTAWQTVEGDD--------RTLAEGVGRHVKQRISREVGVPASVGVAPNMSAA
1302|gene|hvo       AYLDVTDRTAWDLAASGD--------RTLAEGFARYVKQRIAREVGVAASIGVAPNMSTA
                    ****: :   *:                 .   .  :*  *   .** **:*:** *::*

2918|gene|nph       KLASDAEKPDGLVIVDPDSVATFLKPIPVAELHGVGPVTAAELRERGYETAGDVAAADET
2776|gene|hut       KIASDYDKPDGLTVVEPGDVRSFLAPLPVAAVHEVGPKTATELAEMGIETAGDLAAADPA
10540|gene|hma      KVASDRDKPDGLVVVEPGAVREFFDDLPVEDVHGVGPVTARELAALDIETAGDLAAADPE
1102|gene|hhi       KVASDRDKPDGLIVVEPGAVREFFDDLPVEDVHGVGPVTARELASLDIETAGDLAAADPE
1014|gene|nrc1      KLASDHEKPDGLVVVPPESVQSFLAPLDVADLHGVGPVHARALRERGIETVGELADADPY
3359|gene|hwa       KIASDHQKPDGLVVIEPGSVASFLSPLPVESIHGVGPVTADRLSELEVRTAGDLATADRK
2466|gene|hla       KIASDADKPDGLVVVPPGEVESFLASLPTAEIHGVGPVTERTLAELGIETAGDLAAADPD
19230|gene|hbo      KVASDHDKPNGLVVVPPGSVSEFLAPLSVTEVHGVGPVTARKMAEMGIQTAGDLAAADPS
1302|gene|hvo       KIASDFDKPDGLVVVRPGEVRSFLAPISVEEVHGVGPVTARKLGSLGIETAGDLADADAA
                    *:*** :**:** :: *  *  *:  : .  :* ***     :      *.*::* **  

2918|gene|nph       ALVDAFGERGRDIYRQARGEDDRVVEPKGRPKSLSSESAFPKPTDDGDRKRRKLTALAAD
2776|gene|hut       ALADRFGERGRAIYRYARGEDDRDVTPVGRPKSLSRESSLAPAEGDTETVREQVRTLAEA
10540|gene|hma      LLAERFGERGREIRRYARGEDERSVTPKGDPKSLSRESAFTDATTDIEAKCRQVRTLADA
1102|gene|hhi       LLAERFGERGREIRRYARGEDERSVTPKGDPKSLSRESAFTEATAEMEAKCRQVRTLADA
1014|gene|nrc1      VLEAAFGERGREFHRRARGADSRPVEPRGKPKSLSRESSFDGATESFDRVREQAAALSGA
3359|gene|hwa       RLTEVLDSRAETLSKRAMGNDNREVTPTGKPQSLSRESAFAAATEDEAQKRDAISGLATD
2466|gene|hla       RLADELGDRGRELYRRARGDDDREVTPTGLPKSLSRESSLS-ATADEERKRETVRALAAD
19230|gene|hbo      TLEERFGSRGRELYDRARGVDDRAVTPTGRPKSLSRESAFAEATEDTEEKANVVTALAAD
1302|gene|hvo       VLEAEFGSRGRELHERARGYDDRAVTPTGRPKSLSRESAFTDPTDDIKDKREVVRALAAD
                     *   :..*.  :   * * *.* * * * *:*** **::  .  .          *:  

2918|gene|nph       VTERATAKDALYRTVGIKVVEPPFDVHTRERSLSGPVDDPKLVEEIAVDLLA-EFDDPAV
2776|gene|hut       VADRANRRDALYRTIGIKVVSPPFDIHTRERSLSGPVDRPDLVRSVALDLLS-AFADREV
10540|gene|hma      VADRAERKGARYQTIGIKVVTPPFDVNTRARSLPGPVEEPELVRRIALDLLG-EFADDPV
1102|gene|hhi       VADRAQRKGARYQTIGIKVVTPPFDVNTRARSLPGPVEEPDLVRRVALDLLG-EFDDDPV
1014|gene|nrc1      VADRASRTNASYRTIGVKVVTPPYDVQTRAESLPGPVDDPALLEAVSQSLLD-EFEGAAV
3359|gene|hwa       VAARANQRGALYQTIGIKIVIPPYEVRTRERSLSGPIEDADLVVDVACELLS-EFEEEAA
2466|gene|hla       VARRARERGCLYRTIGIKAVEPPYEVNTRARSLPGPVDDPDLVESVALDLLG-EFAGDRV
19230|gene|hbo      VAERARSRGAMYRTIGIKVVTPPYDVNTRAQSLSGPVDDPELVREVALDLLS-EFEDAAT
1302|gene|hvo       VADRARSRGAMYRTIGIKVVVPPFDINTRATSLSGPVDDPELVESVALDLLDAEFAETTV
                    *: **   .. *.*:*:* * **:::.**  **.**:: . *:  :: .**   *    .

2918|gene|nph       RKLGVRVSNLSFDDREQATLG--QWADGTADQEPVRLSHVRRSGE---------------
2776|gene|hut       RKVGVFVSGLSFSAGDQASLG--EWDDAGGDTETVAHDDETATSFRSPSGN---------
10540|gene|hma      RKVGVRVSNLDFSAGEQANLD--GFGGDNGSEEASGSSRTSSTPAAADELDDDGQVGLGT
1102|gene|hhi       RKVGVRVSNLDFSAGEQANLD--GFGGGSGTEETTDSSVADNSSETAKEQDEEGQVGLGT
1014|gene|nrc1      RKVGVRVSNLVFSEREQATLA--GFSGDETG-DGGGHEGGACGGAGRGS-----------
3359|gene|hwa       RKIGVRVSNLSFAAADQAQLDACEWDSDRSCVPTAPVDDAPDDNNTKDINE---------
2466|gene|hla       RKLGVRVSKLDFAESDQATLG--GFDASGGGRGTAGGDSGADRDRESEAQSVATDGEGGK
19230|gene|hbo      RKVGVRVSNLSFTDADQSSLD--GWEGASASATEDATTAGAMEDAPVADSP---------
1302|gene|hvo       RKLGVRVSKLSFADADQSSLD--GWESAEAGETGGDGDERVSDEPPNTGGE---------
                    **:** ** * *   :*: *    :                                   

2918|gene|nph       ----------------------------TDTQLELSQFE----
2776|gene|hut       --------------------------QRLSGQTTLADFR----
10540|gene|hma      FVANDGDTEAVEDTAGEGTDASETHISLPPGQTTLAEF-----
1102|gene|hhi       F----GESEAAGDTMDEDGGPADTHISLPPGQTTLADF-----
1014|gene|nrc1      ----------------------------CGGQTTLDEFT----
3359|gene|hwa       ----------------------YPHQPYSSGQVSLGEFGTEHD
2466|gene|hla       LTDWVGGEPNAGDAGEADETGDRPTSETGDGQASLGDWS----
19230|gene|hbo      -------AEDIPAAEQPTEDAEDSGWAAENGQVSLGDFD----
1302|gene|hvo       -------------------------APSRGGQSSLVEFD----
                                                   *  * ::