HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0167COG1053KOG2404 KOG2403arCOG00571Succinate dehydrogenase/fumarate reductase flavoprotein subunitsuccinate dehydrogenase subunit A

HOG Organism Gene ID Name Annotation
cHOG0167 nrc1 VNG1306 sdhA succinate dehydrogenase subunit A
cHOG0167 hmu HMUK2079 Hmuk_2079 succinate dehydrogenase or fumarate reductase, flavoprotein subunit( EC:1.3.99.1 )
cHOG0167 hma RRNAC1097 aor3 flavin-containing amine-oxidoreductase
cHOG0167 hwa HQ2994A sdhA succinate dehydrogenase, subunit A (flavoprotein)
cHOG0167 hla HLAC1990 Hlac_1990 succinate dehydrogenase or fumarate reductase, flavoprotein subunit
cHOG0167 hbo HBOR12870 Hbor_12870 succinate dehydrogenase subunit A( EC:1.3.99.1 )
cHOG0167 hut HUTA2832 Huta_2832 succinate dehydrogenase or fumarate reductase, flavoprotein subunit
cHOG0167 hvo HVO_2808 HVO_2808 sdhA succinate dehydrogenase flavoprotein subunit A
cHOG0167 nph NP4264A sdhA succinate dehydrogenase, subunit A (flavoprotein)
cHOG0167 hhi 1707 sdhA2 succinate dehydrogenase subunit A (flavoprotein)
MUSCLE (3.6) multiple sequence alignment


10970|gene|hma      ---MARNLAVVGAGGAGAAAAYALRDADVNVTVFEKSRGV--------CGRAATRRHGDC
1306|gene|nrc1      --MYEHDVIVVGGGGAGLRAAIAAQEEGADVAIVTKLHPVRSHTGAAEGGINAALRDGDS
2832|gene|hut       --MYEHDVIVVGAGGAGLRAAIAAKEEGADVALVTKLHPVRSHTGAAEGGINAALQDEDS
1990|gene|hla       --MHEHDVIVVGAGGAGLRAAIAAQEAGADVAIVSKLHPVRSHTGAAEGGINAALRDADS
2994|gene|hwa       --MHEHDVIVVGAGGAGLRAAIAAQEEGADVAIVSKLHPVRSHTGAAEGGINAALREGDS
12870|gene|hbo      --MHEHDVIVVGAGGAGLRAAIAAQEEGADVAIVSKLHPVRSHTGAAEGGINAALREGDS
4264|gene|nph       MTIHEHDVIVVGAGGAGLRAAIAAHEEGADVAMVTKLHPVRSHTGAAEGGINAAIRDGDD
1707|gene|hhi       --MYEHDVIVVGAGGAGLRAAIAADEEGADVALVTKLHPVRSHTGAAEGGINAALQEGDS
                         .:: ***.****  ** *  : ..:*::. * . *         *  *: .  * 

10970|gene|hma      ----TYE------------------------------YGANYLKADDGRVTE--------
1306|gene|nrc1      WEDHAYDTMKGSDYLGDAPAIDTFAKTAPDEVIQLEHWGMPFSREDDGRVSQRPFGGLSF
2832|gene|hut       WQDHAYDTMKGSDFLGDAPAIETLASDAPEDVIQLDHWGMPFSREEDGTVSQRPFGGLSY
1990|gene|hla       WEDHAYDTMKGSDYLGDAPAVEALCRESPEEVIRLEHWGMPFSREDDGRVSQRPFGGLSF
2994|gene|hwa       WEDHAYDTMKGSDYLGDAPAIETLAQDSPEEVIQLEHWGMAFSRDDDGRVSQRPFGGLSF
12870|gene|hbo      WEQHAYDTMKGSDYLGDAPAIETLCQDSPEEVIQLEHWGLAFSRDDDGRVSQRPFGGMSF
4264|gene|nph       WELHAYDTMKGSDYLGDAPAIETLAQDAPEEVIQLEHWGMPFSREDDGRVSQRPFGGLSF
1707|gene|hhi       WDLHAYDTMKGSDYLGDAPAIDTFAKDAPEEVIQLEHWGMPFSREDDGRVSQRPFGGLSY
                        :*:                              :*  : . :** *::        

10970|gene|hma      ----------------LVTETLPTEGL-------------VDIEEP-------VYAFD-R
1306|gene|nrc1      PRTTYAGAETGHHMLHTLYEQVVKRGIEVYDEWYVSELAVTDEDNPNDRECHGVVAWDVQ
2832|gene|hut       PRTTYAGAETGHHLLHTMYEQVVKRGIEVYEEWYVTDLAVTDDDDPEDRTCHGVAAYDIK
1990|gene|hla       PRTTYAGAETGHQMLHTMYEQVVKRGITVYDEWHVMELAVTDEDDPADRTCHGVVAYDIQ
2994|gene|hwa       PRTTYAGAETGHQLLHTMYEQLVKRGIEVYDEWHVLDLAVTDDERPEDRRCHGVVGYDIQ
12870|gene|hbo      PRTTYAGAETGHQLLHTMYEQLVKRGIEVYDEWYVTRLAVSDEEDPEDRTCHGVVAYDIK
4264|gene|nph       PRTTYAGAETGHHLLHTMYEQVVKRGIKVYDEFYVSELAVTDHDDPEDRECHGCVAYDIK
1707|gene|hhi       PRTTYAGAETGHHLLHTMYEQAVKRGIEVYDEWYVTQLAVTDHDDPEDRVCHGCVAYDIK
                                     : *   . *:              * : *         .:* .

10970|gene|hma      TGDIGTGRDADEHKWTYEAGITQVAKRLFNEADADVEN-------GVRVERLER------
1306|gene|nrc1      SGEI-AGFKASDSVILATGGIGQAFDHTTNAVANTGDGVAMAYRAGVPVEDMEMIQFHPT
2832|gene|hut       TGEV-EGFRAREAVILATGGLGQVFDHTTNAVANTGDGQAMAYRAGVPLEDMEFVQFHPT
1990|gene|hla       SGEI-SGFSAKNGVILATGGMGQVFDHTTNAVANTGDGVAMAYRAGVPMEDMEFIQFHPT
2994|gene|hwa       SGSI-EGFQARNGVILATGGLGQVYDHTTNAVANTGDGVAMAYRAGAPLEDMEFIQFHPT
12870|gene|hbo      SGEI-SAFHARNGVILATGGPGQVFDHTTNAVANTGDGPAMAYRAGVPMEDMEFIQFHPT
4264|gene|nph       SGDI-VGFRATGGVILATGGDGQVFDHTTNAVANTGDGPAMAYRAGVPVEDMEFVQFHPT
1707|gene|hhi       SGEI-QGFRANNGVILATGGLGQAFDHTTNAVANTGDGCAMAYRAGVPMEDMEMIQFHPT
                    :*.:  .  *        .*  *. ..  * .    :.       *. :* :*       

10970|gene|hma      -------------QRDGWRLEDDEGADL------GHFDAALLTPPAPQTADL--LGQSR-
1306|gene|nrc1      TLPSTGVLISEGVRGEGGILYNGEGERFMFEHGYATNDGELASRDVVSRAELTEINEGRG
2832|gene|hut       SLPSTGVLISEAVRGEGGILYNDDGERFMFEYGYANNEGELASRDVVSRAELTEVNDGRG
1990|gene|hla       TLPSTGVLISEGVRGEGGILYNSEGERFMFEHGYANNDGELASRDVVSRAELTEVNEGRG
2994|gene|hwa       TLPSTGVLITEGVRGEGGILYNDEGERFMYEHGYANNDGELASRDVVSRAELTEVNEGRG
12870|gene|hbo      TLPSTGVLITEGVRGEGGILYNEDGERFMFEYGYANNDGELASRDVVSRAELTEVNEGRG
4264|gene|nph       TLPSTGVLISEGVRGEGGILYNSEGERFMFEYGYANNDGELASRDVVSRAELTEVNEGRG
1707|gene|hhi       TLPSTGVLISEGVRGEGGILYNDNEERFMFEHGYANNEGELASRDVVARAELTEVNEGRG
                                 . :*  * : :   :      .  :. * :  .   *:*  :.:.* 

10970|gene|hma      ----WDHDDCRELRQEIAAVPYRTVISGVLHY----PFELDVPW-----YA--AVNSDKE
1306|gene|nrc1      VDDEHIYLDMRHLGEERITDRLENILHLAEDFEGVNGLEEPMPVKPGQHYAMGGIETNEF
2832|gene|hut       IDDEYIHLDMRHLGEERIMDRLENMVHLAADFEGVDALEEPIPVKPGQHYQMGGIETNEN
1990|gene|hla       IEDEYVHLDMRHLGEERILDRLENILHLAEDFEGADGLTEPMPVKPGQHYAMGGIETNEF
2994|gene|hwa       IEDEYVHLDMRHLGEDRITDRLENIIHLSADFEGVNPLEEPMPVKPGQHYAMGGIETDEN
12870|gene|hbo      IEDEYVHLDMRHLGEERIIDRLENIVHLSEDFEGVDPLEEPMPVKPGQHYAMGGIETDEN
4264|gene|nph       INDEYVFLDMRHLGDERINDRLENIIHLAEDFEGVNPVEEPMPVKPGQHYHMGGVETNEH
1707|gene|hhi       VEDEYVDLDMRHLGEERILDRLENILHLAEDFEGVDGLDEPMPVKPGQHYAMGGIECDEN
                            * * * ::       .::     :     .   :*      *   .:: :: 

10970|gene|hma      HDI---GWVGREEC------------------------KDGHVPDGESLLLVQM----NE
1306|gene|nrc1      GETCVSGLYAAGECACVSLHGANRLGGNALPELIVFGALAGRHAAGKEMADPLIETGPSD
2832|gene|hut       GETCIEGLYAAGECACVSVHGANRLGGNALPELFVFGKRAGYHAAGRDMKAAEIPVGPSA
1990|gene|hla       GETVIGGLYAAGECACASVHGANRLGGNALPELIVFGKRAGRHAAGEEMGEAEVTTGKDG
2994|gene|hwa       GETCITGLYAAGECACASVHGSNRLGGNALPELIVFGARAGHHAAGRDLGRAEIPTGKRG
12870|gene|hbo      GETCISGLYAAGECACASVHGSNRLGGNALPELIVFGKRAGHHAAGRDLGEAKIETGQRG
4264|gene|nph       GETCIDGLYAAGECACASVHGSNRLGGNALPELIVFGARAGHHAAGRDLGTAEVPTGPSA
1707|gene|hhi       GETCIDGLYAAGETACVSLHGANRLGGNALPELLVFGARAGHHAAGKDMKTAEIQTGPSA
                     :    *  .  *                           *  . * .:    :      

10970|gene|hma      PWSIAN-YDE---------------------------HPDTLIDDIASRTARLLDDDRLA
1306|gene|nrc1      ALEHDE-LSVPTGAPDGDAGVAEPATDGGAQGAVDTRAPTDVVAD-TATTEEERIEALLG
2832|gene|hut       RTETSD-VSPAVDPGTVEGASDDVAADGGVTA-----DPTAVVER-EVETERERIEGLLE
1990|gene|hla       EWEPAD-YEFEVEVGE-TGGQDPAAADGGAVAT----DPDGVLEA-EVESAKDRVEELLS
2994|gene|hwa       DWEPGA-VDTPVEPGSVRPSGDAVADGGTAAASTAAQSPTGLVER-ATEEARTHVDSLLA
12870|gene|hbo      EWEVGE-VETPVEPGAVSSGEDVVADGGAAAGSL---SGEEYVQR-ALDAERERVESLLE
4264|gene|nph       ETEREEGLETPVDPGALDTGDSDVAADGALV------EPDELVEQ-AVETERQRVEELLE
1707|gene|hhi       KSEPGD-VEPPVEPGAIDAGSDDVAADGAAV------EPKAVLES-TVEQERQRVEDLIE
                      .     .                                 :            :  : 

10970|gene|hma      DPDWTDHQHWR--------------------------------------YSQPEGEVDHD
1306|gene|nrc1      REDGVNHADVRADLQQSMTENVNVFRTEDGLKQALADIQDARKRYQDVYVADKSRTFNTD
2832|gene|hut       R-DGTNHAEVRAEVQETMTEHVNVFRTEDGLETALEELQKARRAYQDVAVEDPSRTFNTD
1990|gene|hla       R-KGRNHAETRSKVQQTMTANVNVFREEGRLEETLSDLHEARETYKDVAVSDPSRTFNTD
2994|gene|hwa       NDDGRNHSEIRDAVQSTMTENVNVFREEESLKQAVEDIRNARRAYQNVGVADQSRTFNTD
12870|gene|hbo      KDDGVQHAEIRAEVQQTMTQHVNVFREKDGLKEALRDIRKAREKYEDVYVADKSRTFNTD
4264|gene|nph       S-DGINHAEIREDLQKAMTENVNVFREEEGLKEALEVIRECRERYQNVAVSDPSRTFNTD
1707|gene|hhi       S-DGINHAEVRADVQETMTENVNVFRTEAGLEKALQDLRTARKEYENVAVEDPSRTYNTD
                      .  :*   *                                        : .   : *

10970|gene|hma      LLSCAAEHDLH---------------FAG-------------DWVA--------GEGRLH
1306|gene|nrc1      LQHTIETRNLLDVAEMITIGALARDEFRGAHWRKEHQERKDDEWLKHTMVSWNDGDPDLW
2832|gene|hut       LIHTLETRNIIDLAETIALGALARTEFRGAHWRAEHQTRKDDEWLKHTMIAWDDGDLDLY
1990|gene|hla       LIHTMETRNILDIAEALTMGALARREFRGAHWRKERQERDDENWLKHTLVSWNDGEPELW
2994|gene|hwa       LLHTIETRNIIDLAEAITLGALARDEFRGAHWRKQYQERDDQSWLKHTLLSWNDGSPELW
12870|gene|hbo      LIHTIETRNILDTAEAITLGALARDEFRGAHWRKEHQERKDDKWLKHTLLSWNDGEPELW
4264|gene|nph       LIHTIETRNLIDVAETITLGALAREEFRGAHWRQQYQERRDDEWLKHTMISWNDGSPKLY
1707|gene|hhi       LIHTIETRNILDVAEAITLGALAREEFRGAHWRAEHQERKDDEWIKHTMLAWNEGTPELY
                    *      .::                * *             .*:         *   * 

10970|gene|hma      ---AALRNGLETGEAIADSR
1306|gene|nrc1      YRPVLLEGHDDTYEPKTRSY
2832|gene|hut       FVPVILDGENKTYEPVDRSY
1990|gene|hla       YKPTILEGENKTYEPKTRSY
2994|gene|hwa       YKPVILEGESKKYEPKIRSY
12870|gene|hbo      YRPVVLEGENKTYEPKVRSY
4264|gene|nph       YKPVILEGENKEYEPKVRSY
1707|gene|hhi       YKPVILEGDEETYEPKVRSY
                       . * .  .  *.   *