HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0166COG1446KOG1592arCOG04779Asparaginaseputative L-asparaginase

HOG Organism Gene ID Name Annotation
cHOG0166 nrc1 VNG1872 asgX putative L-asparaginase
cHOG0166 hmu HMUK1507 Hmuk_1507 peptidase T2 asparaginase 2( EC:3.5.1.1 )
cHOG0166 hma RRNAC3420 ans asparaginase family protein
cHOG0166 hwa HQ3036A asnA asparaginase
cHOG0166 hla HLAC2332 Hlac_2332 peptidase T2 asparaginase 2
cHOG0166 hbo HBOR09920 Hbor_09920 asparaginase( EC:3.5.1.1 )
cHOG0166 hut HUTA0415 Huta_0415 peptidase T2 asparaginase 2
cHOG0166 hvo HVO_2589 HVO_2589 asparaginase
cHOG0166 nph NP2432A asparaginase
cHOG0166 hhi 648 ans asparaginase family protein
MUSCLE (3.6) multiple sequence alignment


3036|gene|hwa       --------------MRIIIHGGAGDSPEAPAQRQSILDETATHAVSSDTPIDAVETALRE
1872|chp|nrc1       --------------MRVLVHGGAGAPPDAPAPRQDTLETAADTGASHATPVDAVTAAVRV
2332|gene|hla       --------------MRVIAHGGAGGVPDEPASRQATLDEATRRGVDADTPLDAVEAALGV
9920|gene|hbo       --------------MRVIVHGGAGGVPDEPDPRQQTVDEAAETGAARETPIDAVEAAIRV
13420|gene|hma      MVGGDMPFVCQRVRMHVIVHGGAGSPPESPATRQKTLTDAAEQATEAARPMGAVLAALRP
648|gene|hhi        --------------MHVIVHGGAGSPPESPATRQETLTDAAEQATAAEGPMDAVLAALRP
415|gene|hut        --------------MQVIAHGGAGSSPDDPSSRQAVLDDAAASGLEAETPLDTVVATIAP
2432|gene|nph       --------------MRTIVHGGAGTAPAEPNERLAVLEGAADAGADAQTPTEAVCAAIRR
                                  *. : *****  *  *  *   :  ::  .     *  :* :::  

3036|gene|hwa       LESVDQFNAGSSGAVQTDGVPRTDAGMMRSSQDIGAACAMTGVEHAISAARVVCEETPHV
1872|chp|nrc1       LERDPAFNAGTGATPQSDGVIRTDAGMMTSDRAAGAAASMPGVEAAVAVARAVMADTPHV
2332|gene|hla       LESNPRFNAGVGGAVQSDGVVRTDAGVMTADREIGAACSMPGVEHAASVARVVHSETPHI
9920|gene|hbo       MESDPAFNAGVGGAVQSDGRVRTDAGVMTSDRETGAVAGMDGVEHAVSVARVVMEETPHI
13420|gene|hma      LESDPAFNAGVGGAIQSDGEVRTDAGLMTDDGGVGAACAMSGVVHAADVAHTVATETPHV
648|gene|hhi        LESDPAFNAGVGGAVQSDGEVRTDAGLMTDDGRVGAACAMSGVVHAADVSYTVATETPHV
415|gene|hut        LESDPAFNAGVGSAVQSDGTIRTDAGVMTDDGEVGAACAMTGVEHAIDAACAVLENTPHV
2432|gene|nph       LESAPRFNAGVGSAVQSDGYIRTDAGLMTDDRSVGAAAGMPGVEHAIDVARTVKDETPHV
                    :*    **** ..: *:**  *****:*  .   **...* **  *  .: .*  :***:

3036|gene|hwa       LLAGEQAVALAADYGVRTDVDLWSDADRTRWDA-ADIPSGGSQDTLEWVADRFG------
1872|chp|nrc1       LLSGVHAVDFAADTGIPVESDLWTADTRARWDDLDSHPDGSPTDHRDWVRERFGRTDP--
2332|gene|hla       FISGDHAVDLASEFDIETGVDLLTDETRERYEA-EDPPQGGPREHLDWLATRFGSGDDQA
9920|gene|hbo       FVAGDPAVDVAADFGIETDVNLFTPETRERWND-ATPPEGTSQDHLAWLDDKFG------
13420|gene|hma      LLAGDEAVEFAAGTGVETGRDLTTAETRQRYER-ADPPDGGPADHLDWVREHFS------
648|gene|hhi        LLAGDEAVDFAAGMGVETGRDLTTAETRQRYEA-ADPPDGGPADHLEWVREHFS------
415|gene|hut        LLAGERAVEFAGAHGIETDADLWTDRTRDRWGA-TSQPGESVADQLAWLAEHFD------
2432|gene|nph       LVAGVHAVDLAETVGVETTVDLWTDRTRQRWDDLDTKPPDELGDQLAWVTDRFG------
                    :::*  ** .*   .: .  :* :   * *:      *     :   *:  .*.      

3036|gene|hwa       --G----------------YDTVGAVAHDGNQYAAGTSTRGRWFALAGRVGDVPQVGSGF
1872|chp|nrc1       --GGRESPP--------GDHDTVGAVASDGDRFATATSTGGRWLALAGRVGDVPQIGAGF
2332|gene|hla       GGGSGSDEESEDDAGRAPDHDTVGAVATDGETFAAATSTGGRSFALAGRVGDVPQVGSGF
9920|gene|hbo       -----QSSATASNDADLSDHDTVGAVAFDGRDFAAATSTGGRWFALAGRVGDVPQVGSGF
13420|gene|hma      --G----------------TDTVGAVATDGDRLAAATSTAGRWFALAGRVGDVPQVGAGF
648|gene|hhi        --G----------------TDTVGAVATDGDRLAAATSTAGRWFALAGRVGDVPQIGAGF
415|gene|hut        --G----------------HDTVGAVATDGERIAAGTSTGGRWGALAGRVGDVPQVGAGF
2432|gene|nph       --GDPAGRDG-------TDHDTVGAVATDGDRIAAGTSTGGRWLALAGRVGDVPQVGSGF
                                        ******* **   *:.*** **  ***********:*:**

3036|gene|hwa       YCSPDGGASATGAGEDIARVTLSRIAVNHLMSGHTADEAATAALETFIDTTASEAGLIVM
1872|chp|nrc1       YAAPAGAASATGAGEAIAKTTLSRRAVRHLEAGLGAQAAADRAIEEFSELTGASAGVIVV
2332|gene|hla       FCTEAGGASATGAGEDIARVTLSRRAVDFLDDGFGAQDAADRAIDEFEDITGSGAGVIVL
9920|gene|hbo       YAAPAGAASATGAGEDIAKTTLTRRAVRHLERGEDAQSAAELAIEEFAELTGSGAGVIVA
13420|gene|hma      YADGRGGASATGEGEAIARFGVARRAVELLDT-YGPKQAAEEAIAEFEDATGGRAGVIVL
648|gene|hhi        YADDRGGASATGEGEAIARFGLARRAVELLDT-YGPRQAAEEAIAAFEDATGRRAGVIVL
415|gene|hut        YASPAGGASATGAGEDIARDALARAAVDRLEDGQQPQTAAEAAIASFEGSAEGTAGVIVL
2432|gene|nph       YCTPAGGVSATGAGEDIARQTLARSAADRLDAGDDAQRAVEAAIDDFDEAVEGTAGLIAL
                    :.   *..**** ** **.  ::* *.  *     .  *.  *:  *   .   **:*. 

3036|gene|hwa       GAET-VGIATNAHTMQTSVAQR-
1872|chp|nrc1       DRDGGCGTAHNAAAMQTARH---
2332|gene|hla       GDDG-AGSAFNTDGMQTSIAYQ-
9920|gene|hbo       DDEG-VGSAYNTEGMQTGVAER-
13420|gene|hma      DHAGHTGAERNTAAMQTATK---
648|gene|hhi        DHAGHTGAERNTAAMQTATR---
415|gene|hut        DTDGNAGAAYNSDAMQTATAGL-
2432|gene|nph       TPDGDAGAAYSSEAMQTAVSGTL
                          *   .:  ***.