HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0164COG0183KOG1390 KOG1389arCOG01278Acetyl-CoA acetyltransferase3-ketoacyl-CoA thiolase

HOG Organism Gene ID Name Annotation
cHOG0164 nrc1 VNG0678 acaB1 3-ketoacyl-CoA thiolase
cHOG0164 hmu HMUK2810 Hmuk_2810 Thiolase( EC:2.3.1.16 )
cHOG0164 hma RRNAC0929 acaB4 3-ketoacyl-CoA thiolase
cHOG0164 hwa HQ2307A acaB acetyl-CoA C-acyltransferase
cHOG0164 hla HLAC1006 Hlac_1006 Thiolase
cHOG0164 hbo HBOR23830 Hbor_23830 acetyl-CoA acetyltransferase( EC:2.3.1.16 )
cHOG0164 hut HUTA0597 Huta_0597 Thiolase
cHOG0164 hvo HVO_0835 HVO_0835 acaB 3-ketoacyl-CoA thiolase
cHOG0164 nph NP3438A acaB_4 acetyl-CoA C-acyltransferase 4
cHOG0164 hhi 1562 acaB4 acetyl-CoA C-acetyltransferase/3-ketoacyl-CoA thiolase
MUSCLE (3.6) multiple sequence alignment


597|gene|hut        MSTP-IAGVGMTKFGEMADRTGRDLFAEAGETAIEDAGIDRGEIDALYLGNFMGELSERQ
3438|gene|nph       MAEIRVAGTGITDFGEH-DRTTRDLFAEAGLAALDDASVPAEDVEALYYGNFIGELAERQ
10929|gene|hma      MSDPRIAGASVTQFGKHPERTGRDLFAEAGLEALSEAGIDPEDAEALYYGNFMGELAEHQ
1562|gene|hhi       MSDPRIAGASVTHFGKHPERTGRDLFAEAGLEALSQSGIDPDDAEALYYGNFMGELAEHQ
2307|gene|hwa       MGHPRVAGVGLTHFGKHPERTTRDMFAEAGLTALDDAGVDTDDIEGVFYGNFIGEVSEDQ
23830|gene|hbo      MSDVRIAGVGLTPFGEQPERTGRDLFAEAALAAREEAGVPRDAYEGVHYGNFMGAFAERQ
678|gene|nrc1       MTDARVAGVGLTHFGVHPERTSRDLFAEAGLAALDDAGVAREDVAAVHYGNFMGELSEHQ
1006|gene|hla       MIDVRVAGVGLTHFGSHPDRTGRDLFATAALRAFEDSGVPREDVEELNYGNFMGSLAEHQ
                    *    :**..:* **   :** **:** *.  * .::.:       :  ***:* .:* *

597|gene|hut        GHMGPLMAKMLGLDVPATRVESACASGGMAVRQGIQAVRAGTADVVLVGGVERMHNMGTT
3438|gene|nph       GHQGPLVAEAAGLDCPSTRVESACASSGAAVREGVQAIHAG-ADVVVVGGAERMSNMGTE
10929|gene|hma      GHQGPLMAEAIGLDVPATRVEAACASAGTAVREAVKTIRNGEAEVVVVGGAERMTNIGTA
1562|gene|hhi       GHQGPLMAEAIGLDVPATRVEAACASAGTAVREAVKTIRNGEAEVVVVGGAERMTNIGTA
2307|gene|hwa       GHMGPISAEALGIDAPATRIESACASSGVAVREAIKNVRSGESDAVIVGGAERMNNLGTA
23830|gene|hbo      GHQGPLMAEAAGLDCPAMRHESACASAGIAVRQAVRSIRAGEHDVLLAGGMERMTNLSTS
678|gene|nrc1       GHQGPLVAEALGLDVPATRYESACASSGVALRRAVRDVRNGEADVVVVGGAERMNNLETA
1006|gene|hla       GHQAPLMAEAAGVNCPSTRYEEACASAGVAVREAVRTVAAGDADVVLAGGMERMTNLPTD
                    ** .*: *:  *:: *: * * ****.* *:* .:. :  *  :.::.** *** *: * 

597|gene|hut        GATGGLSVAADDLWEIKHGITFPGAYALMAKRYFETHGGDREDLAEVAVKNHANAANNPL
3438|gene|nph       GATEGLATAADDLHEVRAGVTFPGAYALMASAYFHQHGGGPEDLAHIAVKNHDNALVNDH
10929|gene|hma      AATDALAIAADDLYEVRAGMTFPGAYALMARSYFDQYGGSHEDLAHIAVKNHEHALVNEH
1562|gene|hhi       AATDALAIAADDLYEVRAGMTFPGAYALMARSYFDQYGGSHEDLAHIAAKNHEHALVNEH
2307|gene|hwa       ETTASLALAADDLYEVRVGITFPGAYALMADAYFEEYGGSREDLAHIAQKNHENAVDNEF
23830|gene|hbo      RVTESLAIAADELFEVRSGMNFPGAYALMARAYFEEYGGSREDLAHIAVKNHANAVPNEY
678|gene|nrc1       ESTDALAIAADGLYEVRAGMTFPGAYALMAASYFEQFGGSREDLAHIAVKNHANAVDNDR
1006|gene|hla       EVTEGLAIAADDLFEVRAGVTFPGAYALMATAYFDAYGGSRRDLAHIASKNHANAVPNEY
                      * .*: *** * *:. *:.*********  **  .**.  *** :* *** :*  *  

597|gene|hut        AQYQTEITIEKVLDAFPVADPLGLFDASPITDGAAAAIIVSEEYAAEHDLDAPVSITGTG
3438|gene|nph       AHLQQEITVADALDAPQVASPLGLYDACPISDGASAVVLVSDDYAEENDLSAPVAITASS
10929|gene|hma      AQIQKEITVEDAIDAPTIASPLGLYDSCPITDGAAAAVLTTESYAEEHDLDAPVAITGTG
1562|gene|hhi       AQIQQEITVEDAMEAPTIADPLGLYDSCPITDGAAAAVLTTEAYAEEHDLDAPVAITGTG
2307|gene|hwa       AQFQYEIDIDDALDAPPVAEPLHLYDACPVTDGAAAAVIVSEEYAEDNDLDIPVRVTGSG
23830|gene|hbo      AQYRREITVEQAMESLPVATPLHLFDACPITDGASAVVLVSDEYAEEHGLEAPVSITGSG
678|gene|nrc1       AQYQQAITVADALESPPVAEPLHLYDACPVTDGASALVLVSESYADTHDVSAPVAVTGTG
1006|gene|hla       AQYRQEVPVEKALDAPPVAEPLHLYDACPITDGASALVIVSEEYAAEHDVDAPVAVTGTG
                    *: .  : : ..:::  :* ** *:*:.*::***:* ::.:: **  :.:. ** :*.:.

597|gene|hut        QGTDDLALQHRDSITWTPATADAAEEAYADAGIDADDVDFLEVHDCFTIAEVLALEGLGL
3438|gene|nph       QASDHLALHDRESLTETPATEVAAEAAYQEAGIGPNDLDCIEVHDCFTIAEVLALEGLGV
10929|gene|hma      QGGDNLALQDRPHLAQTPAADKAAEEAYGDAGVGPDDVDFAEVHDCFTIAEVFAIESLGF
1562|gene|hhi       QGGDNLALQDRPHLAQTPAADKAAEEAYGDAGVGPDDVDFAEVHDCFTIAEVLAIESLGF
2307|gene|hwa       QGSDNLALQDREYLTQTPAATNAADEAFDDAAIGPDDVDVAEVHDCFTIAEVLALESMGI
23830|gene|hbo      QGGDNLALQDRDAFSRTPAAEKAATAAYEDAGIGPDDVDVAEVHDCFTIAEVLALESLGL
678|gene|nrc1       QGGDKMALQDRQNMATSPAATDAATEAYADAGVSADDVDVAEVHDCFTIAEVMATESLGF
1006|gene|hla       QGTDRMALADREELARTPAADDAADAAYADAGIGPDDVDVAEVHDCFTIAEVLALESLGF
                    *. * :**  *  :: :**:  **  *: :*.:..:*:*  ***********:* *.:*.

597|gene|hut        YDEGEAITAAREGETTADGELPVNLSGGLKAKGHPVGATGLAQISEMTKLFRGDHVNSDA
3438|gene|nph       YETGEAIGAARRGETTRDGELPVNLSGGLKAKGHPVGATGAAQIVELTRQLDGTHPRAP-
10929|gene|hma      YERGEGIAAARNGETTRDGDRPINLSGGLKAKGHPVGATGVAQLATVAWLLDGSHPRADA
1562|gene|hhi       YERGEGIAAARNGETTRDGDLPINLSGGLKAKGHPVGATGVAQLATVAWLLDGSHPRADA
2307|gene|hwa       FDHGDGINAARRGDTLPEGDIPVNLSGGLKAKGHPVGATGAAQIAEMTRLLRGDHHNSEY
23830|gene|hbo      FDHGEAITAAREGKTTRDGSLPVNLSGGLKAKGHPVGATGGAQVVEMTKLLRGDHANSDA
678|gene|nrc1       FDPGAGITAAREGVTTKDGRLPVNLSGGLKAKGHPVGATGTSQVAELTRLLRGDHVNSEH
1006|gene|hla       FEPGEGISAARNGVTTADGDLPVNLSGGLKAKGHPVGATGGSQIAELTRLLRGDHPNSDH
                    :: * .* *** * *  :*  *:***************** :*:  ::. : * * .:  

597|gene|hut        VEDAEVGLTHNAGGTVASAVVHVLEVEQ-------
3438|gene|nph       -DDASVGLAHNAGGTVASVTVHVLEVAE-------
10929|gene|hma      VPDSTVGVAHNAGGTVASTTVHVMEVQE-------
1562|gene|hhi       VPDSTVGVAHNAGGTVASTTVHVMEVQE-------
2307|gene|hwa       VSDASVGITHNAGGTVASTVVHVLEVDQ-------
23830|gene|hbo      LSDPRVGVTHNAGGTVASAVVHVLEVVE-------
678|gene|nrc1       VADAQTAVAHNAGGTVASAVVHVLETVADTEADAA
1006|gene|hla       VADAEVGVAHNAGGTVASAVVHVLEVAE-------
                      *. ..::*********..***:*.