HOG Organism Gene ID Name Annotation
aHOG1638 hbo HBOR16240 Hbor_16240 hypothetical protein
aHOG1638 hmu HMUK0176 Hmuk_0176 conserved hypothetical protein
aHOG1638 nrc1 VNG0492 vng492 no entry
aHOG1638 hma Hma_12006 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


12006|hp|hma      MQIRVYDEGA-VQDCLFVLGWGNRCRHRTVQWLIDQLTTA-YRVHAVELPTHITDYRREW
16240|hp|hbo      MRFSVHGDGG--EDLLFVLGWGNEPDDKHVSWLLDRLTEE-YCVHAVTLPMNGWDFDDQY
492|hp|nrc1       MEISVHGDGDDREPVLVVLGWGNHPGQANVAWLIDGLVAAGWEVHAATLPTNASSFERAY
                  * : *:.:*   :  *.******      * **:* *.   : ***. ** :  .:   :

12006|hp|hma      VGPVQEYAADLGRFDLLGHSAGGLTAAHLD--ADGIGNRVYLSPWWDS--DFPVPGPVLD
16240|hp|hbo      LSPVRTYYEDHDFDVVLSHSTGGLIAAHLADVVDNAPRNVFLSPWWGTAPNDGFESVVLP
492|hp|nrc1       MRPLASYVADRTFDAVVAHSLGGLVTATL----DWDVRRVYLSPWWGV--REGVQSAVFR
                  : *:  *  *     ::.** *** :* *    *   ..*:*****.      . . *: 

12006|hp|hma      AIASLPITKPFIPIDTLDADAIGDLATAQQLAEAPSSVSPAFLRTVFRAQRSLPPARDTA
16240|hp|hbo      YYLQIPTTRRLFSPER-DTPVIGDLKSEDEYDEAPQGISPAFLRTIMDAQARLPYFREQD
492|hp|nrc1       ALAALPMSRPLVP----AAGSVGDI--SEPTPRETTRLSPTFVREVRRAQASLPAFRPDS
                      :* :. :..     :  :**:   :     .  :**:*:* :  **  **  *   

12006|hp|hma      AAFCSLTDTVVDPRAVGERLPADRIRLYDGGHELFSSSGREDTAETVIDTLQHGPDAL--
16240|hp|hbo      VVFCSLSDRMVSVRAIGDRTPTENLRPYDGGHEFFSSSGREAVVEDVLAVLDEGVDAIRG
492|hp|nrc1       TVFCSLTDAIVSVAAIGERTPAANLRVYDGGHEFFSSTGRAAVLDDVIAALRGGPAAVAG
                  ..****:* :*.  *:*:* *: .:* ******:***:**  . : *: .*  *  *:  

12006|hp|hma      ---------------
16240|hp|hbo      PSSTSSYGNVPAEMD
492|hp|nrc1       AST------------