HOG Organism Gene ID Name Annotation
aHOG1636 hbo HBOR06010 Hbor_06010 hypothetical protein
aHOG1636 hmu HMUK1636 Hmuk_1636 conserved hypothetical protein
aHOG1636 nrc1 VNG1734 vng1734 no entry
aHOG1636 nrc1 VNG1758 vng1758 no entry
aHOG1636 hma Hma_10943 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


6010|hp|hbo       ---MLGSLSPLEVTGLVVSLIGLVPVLTQYRDETKLFTAGYVLLVVGMVATNLETFALEP
1758|hp|nrc1      -MAAIGAFGVLEVVGLIVAVLGLFPVVSQYKESTKLFTVGYLLLVVGMVATNLEAVVLPV
1734|hp|nrc1      MMGILEVLDPPKAVLPLIALIGLVPVVARYRTESRWFVVGYGLLAVATLATNLENIVLGD
10943|hp|hma      MQTGLAALDPHKAVLPIVALIGLIPVLLYYRRSSRLFVVGYVLLILATVVTNVENLFLGT
                      :  :.  :..  :::::**.**:  *. .:. *..** ** :. :.**:* . *  

6010|hp|hbo       VLNVVEHAIGIGAAGVVFLAAAYVRRESVV----------------------KG----
1758|hp|nrc1      VLNATEHVVGIGLAGVTFLFAAYQRRQGMT----------------------ATEDTA
1734|hp|nrc1      VLNGTEHALGLMGSGIAFLVAGYYRRQTIL--DPQSDDAATG-----DAAPAAEGDDQ
10943|hp|hma      VLNYAEHYLGLMGSGLVFLFAAYVRRKQVLADDAGGDGPEIGLEDGPDVAADGGRTEP
                  *** .** :*:  :*:.** *.* **: :