HOG Organism Gene ID Name Annotation
aHOG1635 hla HLAC2190 Hlac_2190 hypothetical protein
aHOG1635 hmu HMUK2061 Hmuk_2061 conserved hypothetical protein
aHOG1635 hut HUTA1582 Huta_1582 conserved hypothetical protein
aHOG1635 hwa HQ1602 hypothetical protein
aHOG1635 nph NP3120 hypothetical protein
aHOG1635 hma Hma_12543 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


1602|hp|hwa       MIIPLSHELLTHIIHSDTQGYELYQTASILSICTDCRRMSDDDPTVPVVCEDCGTDTRVS
2190|hp|hla       --------------------------------------MSTDEPSVPIVCTDCETETSVP
1582|chp|hut      ------------------------------MVAVEVPGMSDDEPAVPIVCDECETTAEIP
3120|hp|nph       -------------------------------------MTDEDPPEIPILCSECDTRTKIP
12543|hp|hma      --------------------------------------MTTDQPEIPVVCEACGTRTSVA
                                                           * * :*::*  * * : :.

1602|hp|hwa       LSDLRETLDRHNENQHDGDDVAQVAPRIANELANVVAEDLDLDLDSDENEDEDE
2190|hp|hla       LSDVADALAKHNDGKHDGEEIAEVDPALKDQLADLVAEDLGL--------FDEA
1582|chp|hut      LSDLADQLDAHNERMHDGESVAEVDPDVADQLADLIADELGL--------LEG-
3120|hp|nph       FPEVEATVERHNEQLHDGEPVAQVDPAVFDELADFVAEDLGL--------YEDA
12543|hp|hma      FEDVEDAVARHNEQLHDGDPVAEVDPDVLEELADRLAKDIGL--------LE--
                  : ::   :  **:  ***: :*:* * : ::**: :*.::.*         :