HOG Organism Gene ID Name Annotation
aHOG1630 hbo HBOR14460 Hbor_14460 thymidylate synthase( EC:2.1.1.45 )
aHOG1630 hla HLAC2166 Hlac_2166 thymidylate synthase
aHOG1630 hmu HMUK3006 Hmuk_3006 thymidylate synthase( EC:2.1.1.45 )
aHOG1630 hwa HQ2456 thyA thymidylate synthase
aHOG1630 nph NP2924 thyA thymidylate synthase
MUSCLE (3.6) multiple sequence alignment


2456|gene|hwa       MHQYRDLVTAVLRSGEHKPNRTGVDTISSFSQHYTINLRDGFPLLTTKDLSGSRWHSLLS
2924|gene|nph       MQQYHDLVSDVLAGGTHKPNRTGVDTIASFSHHYEVDLGAGFPLLTTKRMDGYRWNSLIH
2166|gene|hla       MQQYLDLVDDTLSTGTYKPNRTGVDTIATFSGQYTVDLSEGFPLLTTKKMDGYRWNSLIH
14460|gene|hbo      MRQYLDLVTDVLSNGQHKPNRTGVDTISAFSRHYEVDLQEGFPLLTTKDLSGFRWNSLIH
                    *.** ***  .*  * :**********::** :* ::*  ******** :.* **:**: 

2456|gene|hwa       EFVWYLSGEEHIRSLREETSIWDAWADDDGRLETAYGRFWRRYPVPSTDSQLPGEAWPVD
2924|gene|nph       ELLWYLSGEEHIRTLREETKIWDAWADDEGHLDTAYGRFWRRFPVPDEPARLPGESWPDD
2166|gene|hla       EVLWYLSGEEHIRDLREETKIWDAWADDEGRLDTAYGRFWRRFPVPDGVDALPGETWPKD
14460|gene|hbo      EFVWYLSGEEHIRTLREETGIWDAWADEEGRLDTAYGRFWRRFPVPDE--GLPGEAWPED
                    *.:********** ***** *******::*.*:*********:***.    ****:** *

2456|gene|hwa       DHRWRN-DDG-------TFDQLAYAIEQLQENPQSRRIVISAWHPANAAISTLPPCHYTF
2924|gene|nph       SHRWTTTETTPDGTERQVFDQLAYVLDTLEENPHSRRLVVNAWHPANAAVSTLPPCHYTF
2166|gene|hla       AHRWVTVEEGPEGVERRTFDQIQYVLDTLDENPRSRRMVVNAWHPANAAVSTLPPCHYTF
14460|gene|hbo      THRWMN-DEG-------TFDQIQYVLDTLRENPNSRRMVVNAWHPANAAVSTLPPCHYSF
                     *** . :         .***: *.:: * ***.***:*:.********:********:*

2456|gene|hwa       VFNVQNNRLNVHLTQRSGDIALGVPFNIAAYSLLATVIAQQTELTPGTFAHSIVDAHIYC
2924|gene|nph       VFNVQGDQLNVHLTQRSGDIALGVPFNLAAYSLLAHAVANRTAFEVGSFGHTIVDAHIYC
2166|gene|hla       VVNVQDGRLNLHLTQRSGDIALGVPFNIAAYALLANALAQRTGFEIGEFGHTVVDAHIYC
14460|gene|hbo      VFNVQGDKLNLHLTQRSGDIALGIPFNIAAYALLATAVAQRTGFEVGKFAHTVVDAHVYC
                    *.***...**:************:***:***:*** .:*:.* :  * *.*::****:**

2456|gene|hwa       GMGDRGAWYGEGETLDSLRNRLEAVDNPSEYRDVRSWLLESAPSEPANQSGYDHIPGLLE
2924|gene|nph       GAGDRGAWY--ADKLPALQDRLNDIDDREEYVDVREWLESEAPAEADDEGGLDHVPGLLT
2166|gene|hla       GRGDRGQWY--ANNLRYVQDRLATVESKADYLDVKSWVERTAPDEADGEERYDHVPGLLE
14460|gene|hbo      GEGDRGAWY--GDHLSDLQTRLADVSSRDEYLDVRDWLVEAAPAEAEGKERYDHVPGLLK
                    * **** **  .: *  :. **  :..  :* **..*:   ** *. .:   **:**** 

2456|gene|hwa       QCARSPRSKPQVAIDDVSLDDIGVENIHLSGYDPAPAIRFAVAE
2924|gene|nph       QLSRSPRDRPEIEVADRPLDDLEYDDVQLHDYDPAPGISFSVAE
2166|gene|hla       QLSREPRERPRIEIADKPLDELTYEDIEVVDYDSADGISFAVAE
14460|gene|hbo      QCAREPGDRPTIDVADVPLDELTYDDIELHDYDPDEGIRFAVAE
                    * :*.* ..* : : * .**::  ::: : .**.  .* *:***