HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0163COG0074KOG1255arCOG01339Succinyl-CoA synthetase alpha subunitsuccinyl-CoA synthetase alpha chain

HOG Organism Gene ID Name Annotation
cHOG0163 nrc1 VNG1542 sucD succinyl-CoA synthetase alpha chain
cHOG0163 hmu HMUK2713 Hmuk_2713 succinyl-CoA synthetase, alpha subunit( EC:6.2.1.5 )
cHOG0163 hma RRNAC0474 sucD succinyl-CoA synthetase alpha chain
cHOG0163 hwa HQ2857A sucD succinate--CoA ligase, alpha subunit (ADP-forming)
cHOG0163 hla HLAC2208 Hlac_2208 succinyl-CoA synthetase, alpha subunit
cHOG0163 hbo HBOR10970 Hbor_10970 succinyl-CoA synthetase (ADP-forming) alpha subunit( EC:6.2.1.5 )
cHOG0163 hut HUTA0439 Huta_0439 succinyl-CoA synthetase, alpha subunit
cHOG0163 hvo HVO_2464 HVO_2464 sucD succinyl-CoA synthase alpha subunit
cHOG0163 nph NP4354A sucD succinate--CoA ligase (ADP-forming), alpha subunit
cHOG0163 hhi 1166 sucD succinyl-CoA synthetase alpha subunit
MUSCLE (3.6) multiple sequence alignment


439|gene|hut        MSILVDEDTRVIVQGITGGEGEFHAEQMIEYGTNVVAGAVPGKGGQEVHGVPVYDTVDRA
2857|gene|hwa       MSIFVDDETRVVVQGITGGEGKFHTSEMITYGTNVVAGAVPGRGGDEINGVPVYNTVDAA
2208|gene|hla       MSIFVDDDTRVVVQGITGGEGKFHAGQMIEYGTNVVAGAVPGKGGQEVEGVPVYDTVDEA
1542|gene|nrc1      MSILVDDDTRVVVQGITGGEGKFHAEQMIEYGTNVVAGAVPGKGGQEVAGVPVYDTVNQA
10970|gene|hbo      MSILVDDDTRVVVQGITGGEGNFHTQQMVEYGTNVVAGAVPGKGGQEVDGIPVYDTVNQA
2464|gene|hvo       MSIFVDDDTRVVVQGITGGEGKFHTRQMVEYGTNVVAGTSPGKGGQDVDGIPVYDTVEEA
4354|gene|nph       MSILVDNDTRVVVQGITGGEGKFHTGQMLEYGTNVVAGAVPGRGGQEVEGVPVYDTVHKA
10474|gene|hma      MSVLVDEDTRVVVQGITGGEGKFHTEQMLEYGTNVVAGAVPGRGGQEVAGVPVFDTVQGA
1166|gene|hhi       MSVLVDEDTRVVVQGITGGEGKFHTEQMLEYGTNVVAGAVPGRGGQEVAGVPVFDTVQGA
                    **::**::***:*********:**: :*: ********: **.**::: *:**::**  *

439|gene|hut        AREEDADASVVFVPPAFAADALFEALDAP-LDVVVAITEGIPTQDVSEVYAELEDTDTHL
2857|gene|hwa       VRTEDANAAVVFVPPRFASDAIFEALDAD-LELVVAITEGIPTQDMTKVHQRLSEVDTRL
2208|gene|hla       VEAENADASVIFVPPAFAADAIFESLDTD-LDLAVAITEGIPTQDMAKVNKRLSEVDTRL
1542|gene|nrc1      VVAENADASVVLVPPAFAADAVFEALDTP-LDLVVAITEGIPSQDMAKVYKRLSEVDTRL
10970|gene|hbo      VEEEDADASVVFVPPAFAGDAVFEALDTD-LDLVVAITEGIPTQDMAKVNKRLSEVDTHL
2464|gene|hvo       VDEEDANASVVFVPPAFAGDAIFEALDTD-LDLVVAITEGVPTQDMAKVNKRLSETDTRL
4354|gene|nph       AREEDANAAVVFVPPAFAADALFEALDSP-VDLVVAITEGIPQQDMAKVYRKLRETDTNL
10474|gene|hma      AREADANAAVVFVPPAFAGDACFEALDAKGIDLVVAITEGIPTQDMARVYRKLQETDTHL
1166|gene|hhi       AREEDANAAVVFVPPAFAGDACFEALDADGIDLVVAITEGIPTQDMARVYRKLQETDTHL
                    .   :*:*:*::*** **.** **:**:  :::.******:* **:: *   * :.**.*

439|gene|hut        VGPNCPGVITPGESKLGILPGNIFSEGSVGLVSRSGTLTYQIVDSLTERGIGQTTAVGIG
2857|gene|hwa       IGPNCPGIITPGQTKLGILPGNIFEPGSVGLVSRSGTLTYQVVSNLTDRDIGQTTAIGIG
2208|gene|hla       IGPNCPGIITPGEAKLGILPGNIFSDGNVGLVSRSGTLTYQVVDNLTERGLGQSTAIGIG
1542|gene|nrc1      LGPNCPGIITPGEAKLGILPGNIFEAGNVGLVSRSGTLTYQVVDSLTARGVGQTTAIGIG
10970|gene|hbo      VGPNCPGLITPGEAKLGILPGNIFESGNVGLVSRSGTLTYQVVSNLTDRGIGQTTAIGIG
2464|gene|hvo       IGPNCPGIITPGEAKLGILPGNIFEEGNVGLVSRSGTLTYQVVSNLTERGIGQTTAIGIG
4354|gene|nph       IGPNCPGLITPGEAKLGILPGNIFAEGNVGLVSRSGTLTYQVVDSLTQRGIGQTTAVGIG
10474|gene|hma      VGPNCPGVITPGVAKLGILPGNIFSSGNVGLVSRSGTLTYQVVDNLTNRGIGQSTAIGIG
1166|gene|hhi       VGPNCPGVITPGVAKLGILPGNIFSEGNVGLVSRSGTLTYQVVDNLTNRGIGQSTAIGIG
                    :******:**** :**********  *.*************:*..** *.:**:**:***

439|gene|hut        GDPIVGTGFIDALELFEADPETEAVVMCGEIGGEDEEAAAEYIAEEMDTPVVGFIAGRTA
2857|gene|hwa       GDPIVGTSFIDTLDAFESDPHTEAVVMCGEIGGEDEEQAAAFITEQMDTPVAGFIAGRTA
2208|gene|hla       GDPIIGTSFIDALDAFEADDDTDAVVMCGEIGGEDEEQAARFIGEHMDTPVAGFIAGRTA
1542|gene|nrc1      GDPIIGTDFIDALELFEADPETEAVVMCGEIGGEDEEAAAAYIDEHMDTPVAGFIAGRTA
10970|gene|hbo      GDPIIGTSFVDALELFEADKDTDAVVMCGEIGGEDEEQAAKYIAENMDTPVAGFIAGRTA
2464|gene|hvo       GDPIIGTSFVDALEAFENDPDTHAVVMCGEIGGEDEEQAAKYIAENMDTPVAGFIAGRTA
4354|gene|nph       GDPIIGTDFVDALEMFENDPDTEAVVMCGEIGGEDEEEAAEFIGANMDTPVAGFIAGRTA
10474|gene|hma      GDPIIGTDFIGALEQFEADPDTHAVVMCGEIGGEDEEEAARFIGEHMDTPVAGFIAGRTA
1166|gene|hhi       GDPIIGTDFIGALEQFEADPDTHAVVMCGEIGGEDEEEAARFIGEHMDTPVAGFIAGRTA
                    ****:**.*:.:*: ** *  * ************** ** :*   *****.********

439|gene|hut        PPGKRMGHAGAIVSGGGTGTAQSKIDALEAAGVEVGETPSDVADLVEDIA
2857|gene|hwa       PPGKRMGHAGAIVSGSGTGTAESKINALTDADVPVGNTPDEVAEYIESFL
2208|gene|hla       PPGKRMGHAGAIVSGSGTGTAQSKIDALNDAGVPVGDTPEEVADHVEDFL
1542|gene|nrc1      PPGKRMGHAGAIVSGSGTGTADSKISALNDAGVPVGDTPEEVADDIEELL
10970|gene|hbo      PPGKRMGHAGAIVSGSGTGTAESKISALNDAGVPVGDTPNEVADHIEDFL
2464|gene|hvo       PPGKRMGHAGAIVSGSGTGTAESKISALNDASVPVGDTPNEVADHIEDFL
4354|gene|nph       PPGKRMGHAGAIVSGSGTGTAESKINALNNAGVPVGDTPEEVADNIESFL
10474|gene|hma      PPGKRMGHAGAIVSGSGTGTAQSKITALEDNGVPVGDTPEEVADHVEDLL
1166|gene|hhi       PPGKRMGHAGAIVSGSGTGTAQSKITALEDNGVPVGDTPEEVADHVEDLL
                    ***************.*****:*** **   .* **:**.:**: :*.: