HOG Organism Gene ID Name Annotation
aHOG1628 hbo HBOR13870 Hbor_13870 methylase involved in ubiquinone/menaquinone biosynthesis( EC:2.1.1.- )
aHOG1628 hla HLAC1953 Hlac_1953 Methyltransferase type 11
aHOG1628 hmu HMUK2783 Hmuk_2783 Methyltransferase type 11( EC:2.1.1.- )
aHOG1628 hwa HQ2416 ubiE menaquinone biosynthesis methyltransferase UbiE
aHOG1628 nph NP3790 homolog 2 to S-adenosylmethionine-dependent methyltransferase 3
MUSCLE (3.6) multiple sequence alignment


2416|gene|hwa       -----------------------MPSAPTDSIRDAFVVANRPIECVLDVGGGTGRAATGL
3790|gene|nph       -----MRWDVQAFDLFAPLYDIWMPSADETALRKGLACADREGDRIIDVGGGSGRAARTV
13870|gene|hbo      MSRLHGRGDVRFFDRIAALYDLVMPSADADALQRGLSFARRPVERVLDVAGGTGRATRAL
1953|gene|hla       ---MYGLGDVRFFDRIAPLYDRVMPPADGETLAAGLDHATRPIDRLLDIGGGSGRAAAAL
                                           **.*   ::  .:  * *  : ::*:.**:***:  :

2416|gene|hwa       RTLGIDTVVMDISMHMLTYAAS-DGHPVVAGDGRHLPIATNAVDAAVIVDALHHIPTPER
3790|gene|nph       G-----ATVVDPAAGMLARARA-KGLETVQASATDLPHPDDSVDAVIVVDALHHFPDPEA
13870|gene|hbo      ARNGLEPVVVDFSRGMLSRARA-DGRDTVHADAGTLPFCDDSVDAIIVVDALHHMPDPDG
1953|gene|hla       T--GPDITVVDASLGMLARAREHRGLSGVAGDAGRLPFRDGSVDAAMVVDAFHHLPDQAA
                           .*:* :  **: *    *   * ...  **   .:*** ::***:**:*    

2416|gene|hwa       ALTELTRVVAPGGIIIIQEFDPTSTLGQALVWAEHRIGFSSTFWTPAELCDELNSPDTES
3790|gene|nph       GLAEISRVLAPGGVLVVREFDRSTRRGRLLEAGEHLFGFESTFYTAAELEAAIEAAGLEA
13870|gene|hbo      AIREAARVVSPGGVVVVQEFGPDTLRGRGLVLAERAIGFDSQFWTPDELCAVFENAGLTA
1953|gene|hla       AIGEAARVIAPGGALVIREFDPTNPLGRVLVASEHAIGMESRFRSPDDLAAALADAGFDP
                    .: * :**::*** :::.**.  .  *. *  .*. :*:.* * :. :*   :  ..  .

2416|gene|hwa       YLVDEGFEYVIVGRMK-------
3790|gene|nph       RPVEYGFETTVCGVAPAGRDDE-
13870|gene|hbo      RLVSSGFEYVVAGRVESAEASHE
1953|gene|hla       RVVDRGFGYTVVGVRE-------
                      *. **  .: *