HOG Organism Gene ID Name Annotation
aHOG1626 hbo HBOR24920 Hbor_24920 Aspartate/tyrosine/aromatic aminotransferase
aHOG1626 hla HLAC0930 Hlac_930 aminotransferase class I and II
aHOG1626 hmu HMUK2962 Hmuk_2962 aminotransferase class I and II
aHOG1626 hwa HQ1237 aspC PLP-dependent aminotransferase ( aspartate aminotransferase)
aHOG1626 nph NP0824 aspC_4 aspartate aminotransferase 4
aHOG1626 hma Hma_10691 aspC4 aspartate aminotransferase
MUSCLE (3.6) multiple sequence alignment


10691|gene|hma      ---MDYTEPQFFRVMQYAARADRDVVDMVSGNPDWDPPEGLRDGLRDYAEASADDYQYPP
824|gene|nph        --MGDYDRPVFFHLMEYAANADRDVVDMVSGNPDWEPPEALREGLAAYVSADVDTFQYPP
1237|gene|hwa       --MNEYDEPLFFQVMQYASNADRDIVDMVSGNPDWEPPDALRDGLHEYADADAADFQYGP
24920|gene|hbo      MGNDAYDEPLFFQVMKYAARADRDVVGMVSGNPDWDPPEALRDGLREYADADADEFQYPP
930|gene|hla        ---MEYEEPKFFHVMQYAGAADGDVIDMVSGNPDWEPPATLREALREYADLPSAEFQYPP
                         *  * **.:*:**. ** *::.********:**  **:.*  *..     :** *

10691|gene|hma      SVGLTPLRDEIAARRGVDRNRVLITNGAGEANHLAMTGGLHHFDGN--EILLTDPVYPYY
824|gene|nph        SEGLAELRAEIAARRGVDRERVVVTNGAGEANYLAMAEALESQPGD--EILLVDPVYPYY
1237|gene|hwa       SEGLTDLREQIGARRNIDSDNIIITHGAGEANYLAMAQAVECSDVNTPEFLLTDPVYPYY
24920|gene|hbo      SEGLRELRETIATRRNVDSSHIVVTNGAGEANYLAMARALERDSGN--EFLLTDPVYPYY
930|gene|hla        SEGLLELREAIAERRNVDADRVVVTNGTGEANYLAIARAFERDAGD--EALLMDPVYPYY
                    * **  **  *. **.:* ..:::*:*:****:**:: ..     :  * ** *******

10691|gene|hma      AGRANFIGADISFVPVDEHNRLAPADVRAAASEETAVIVVNSPNNPTGAVYDAEAMAEFA
824|gene|nph        HKRTELLGGTPTFVAADADGRVDPAAVRAAASDETAAIVVNSPNNPTGAVYGRETKQELV
1237|gene|hwa       PGKASLLDATATHVPVHDDGHLNIDAIQDAASTDTVAIVLNTPNNPTGAVYNRAALNDVA
24920|gene|hbo      PGKATMLGGTATTVPVLESGDPRCGGDARRGLIGDGGHPDQYAEQPDRGVYDRETVEALH
930|gene|hla        PGKTDMLGGESTLVPTERDGGLDVDAIREAASEDTALIVLNTPNNPTGAVYDLDAVREVV
                      .: ::..  : *..   .          .         : .::*  .**.  :   . 

10691|gene|hma      AIAEEYDALLLSDEVYDHFDYAGR-FSSALRADS--DHVVATNSFSKTMAITGFRVGYVI
824|gene|nph        DIAERHDALLVSDEVYDHFVYEPDAFESALAFDS--ANVAVTNAFSKSMAITGFRVGYGV
1237|gene|hwa       AIAADIDALVIVDEVYDHFDFTGD-FESALTLSSYTDRIIVTSAFSKSMAITGFRVGYAV
24920|gene|hbo      DVAAENDALLIVDEVYDHFDFSGD-FESALTLDS--DRVIVTSGYSKSMAITGFRIGYAV
930|gene|hla        AVADAVDALVMVDEVYDHFDLTGE-FESALMLDS--DRVIVTSGFSKSMAITGFRVGYGI
                     :*   ***:: *******      *.***  .*   .: .*..:**:*******:** :

10691|gene|hma      FPPEDGPTGTLLERARTQHMLTNVTGSRPAQYAVLRALKTTSPDYYAACRRRLERRVDDF
824|gene|nph        YPER------LVDDIRTRHMLVNVAGSRPAQHAVLHALRETPAEYYERNRSMLEERIDAF
1237|gene|hwa       FPPA------LVDAAQTRHMLVTVSGSRPAQRAVSDALEKTPPSYYASVRNTIRERIDTF
24920|gene|hbo      FPEE------LVPAAKTRHMLVNVATNRPGQAAVLRALEETPAEYYEGTREMLRDRITSF
930|gene|hla        FPEA------HVGDAKTRHMLVNVAGARPSQYAVHHALAETPPSYYAEARELLADRVDAF
                    :*         :   .*.***..*:  **.* **  **  *...**   *  :  *:  *

10691|gene|hma      CAALAAAGAEYNRPDGGFYVMARFPDFPGSFENVYELIDEAGVAGMPGEAFGESRSDWIR
824|gene|nph        CAALDAAGAEYTRPQGAFYVMARFDGYPGTLAHTERLIDEAGVAGMPGDAFGESRAEWLR
1237|gene|hwa       TNALETIGAAYTEPEGAFYVMARFDDLPGTLENVEYLIDEAGVAGMPGEAFGNAYDDWIR
24920|gene|hbo      TDALDAAGADYTTPRGAFYVLARFDDFPGTLSNVEQLIDEAGVAGMPGEGFGEAYDDWIR
930|gene|hla        TDALDAAGAEYTRPEGAFYVLARFEGFPGTMENVKRLIDEAGVAGMPGDAFGTARGEWIR
                      ** : ** *. * *.***:*** . **:: :.  ************:.** :  :*:*

10691|gene|hma      FALVTSRVDEAAQRLANYFG--
824|gene|nph        FAVVTPRAEEAAERLANYFG--
1237|gene|hwa       FSLCTDRISIAGDRLMTFFQNS
24920|gene|hbo      FALVTPRADEAAARLADYFG--
930|gene|hla        FALVTPRAAEAAERLADYFGD-
                    *:: * *   *. **  :*