HOG Organism Gene ID Name Annotation
aHOG1624 hla HLAC2328 Hlac_2328 Domain of unknown function DUF1850
aHOG1624 hmu HMUK0880 Hmuk_0880 Domain of unknown function DUF1850
aHOG1624 hwa HQ1443 TRAP-type transport system protein
aHOG1624 nph NP0542 tp53_2 TRAP-type transport system protein
aHOG1624 nrc1 VNG0539 vng539 no entry
aHOG1624 hma Hma_12579 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


542|gene|nph       MPRRAWLPIAALSVLVVASAAGIVVSERDVGTQTLVVEDATDGTELLAVAVEPGSEVAIE
12579|hp|hma       -MRRRYVAIAVLGALLLI---GTVAA--LPGGHALVVEDAETGEQYLTVSVEDGTTVALE
539|chp|nrc1       -MNRTRIVVVAASVLAVL----TVIAAVVPAGTVLVADDTDTDQRYLTVPVSEGSTVALE
2328|gene|hla      -MGRLSQPNAGAVILALAVLAFVVVAVTAPIGAVLVVENAETGERYVAEPVNDGSTVALE
1443|gene|hwa      -MQHTTNIRFITGLLVIVLLASTIGTSIAP-GFVLIIEDIDTDETYIRHPVGNGTTFAVE
                      .          * :      : :       .*: ::   .   :  .*  *: .*:*

542|gene|nph       YTHSVERTPVVDVYTVDDGELVMTRSEFQSFGAGLPSRADVALEDGVFVYEPPPKRYAQL
12579|hp|hma       YMHSVEKTRVYDEYTVRGDHLEMTRMEFESFGWGLPSGANVTREDGMYVFD-PPGNYTRV
539|chp|nrc1       YTHSVERSRVYEAYAVRGETLEMTRAEFESYGWGFPSAANVTIENGTFVYS-PDRTATVL
2328|gene|hla      YTHSVEKSRVYDEYRVDGRTLVNTRMEFESYGWGLPARVNVTTVNGTFVYD-PAEPITEL
1443|gene|hwa      YTHSVEKTRVYDEYQVSGQQFVNTRMEFESYGWGLPATANVTNRNGTFVYN-PSGPITTM
                   * ****.: * : * * .  :  ** **:*:* *:*: .:*:  :* :*:. *    : :

542|gene|nph       T---VATGHIADHDLVVDGERYDLAALADGESITLDLEHRLFHGL-------
12579|hp|hma       T---VSPGDVAGHKLHVGAETYDLVARTNGRSVHLYVTQRSSFGAATDQLNT
539|chp|nrc1       T---VSPGRIAGHTLHVDDRSYDLVSVTDAQSVDLHVVHRTLLATMIESIYE
2328|gene|hla      DELFVSPGRIANHTLIVDERQYDFVAVTEGNDVRVHIERRSLLERIL-----
1443|gene|hwa      SELLLSPGRIANHTLIVNDERYNLVIQTNANDVRIHIERQSPMERVV-----
                       ::.* :*.* * *.   *::.  ::. .: : : ..