HOG Organism Gene ID Name Annotation
aHOG1615 hla HLAC2329 Hlac_2329 TRAP transporter solute receptor, TAXI family
aHOG1615 hmu HMUK0881 Hmuk_0881 TRAP transporter solute receptor, TAXI family
aHOG1615 hwa HQ1442 Imp TRAP-type transport system,periplasmic protein
aHOG1615 nph NP0544 tp53_1 TRAP-type transport system periplasmic protein 1
aHOG1615 nrc1 VNG0540 imp immunogenic protein
aHOG1615 hma Hma_12580 imp immunogenic protein
MUSCLE (3.6) multiple sequence alignment


544|gene|nph        MVDTSNLDRRSLLKGVGVAGIAGLAGCTG-NGDGNGNGNG--NGNGNGNGNGNGN-----
540|gene|nrc1       --MPTEHTRRRFLQATGATSIAALAGCAG-GDDGAGDG----------------------
1442|gene|hwa       --MTSDQTRRRFISVVGAAGITGLAGCSG-GGDAGDEGSE--TEADESTEAAESTE----
2329|gene|hla       --MSSHQTRRRFLEATGVAGVAALAGCSGNGGDGSDGSDG--SDGSDGSDGSDGSDGSDG
12580|gene|hma      --MTNNSTRRRFLKTAGVAGVAALAGCGG-GGDGGDGGDGETTEGGDMTEGGDMTEGE--
                       ..   ** ::. .*.:.::.**** * ..*. . .                      

544|gene|nph        ---GDDGAAGEAIGWHAGGTGGTYYPFSQELKDIVETETNHTLQVQSTGASVENVGSLAS
540|gene|nrc1       ----------TRLSWHAGGQSGTYYPLSNEFKTIVEDNTDYSLNVQTTGASVENVGSLAK
1442|gene|hwa       ---ADSGNENTRLSWHAGGTGGTYFPLSNEFKTVVEDNTDFSLNVQSTGASVENVGSLTD
2329|gene|hla       SDGSDGGDGETRLTWHAGGTGGTYFPLSNEIKTIVDANTDFTLNVQSTGASVENVGSLAD
12580|gene|hma      ---MTEGDTETRLSWHAGGTGGTYFPLSNEFKTVVEDNTDFTLNVQSTGASVENVGSLAS
                                : ***** .***:*:*:*:* :*: :*:.:*:**:***********:.

544|gene|nph        GDADFALIQNDIATFATEGRGIAAFEGNPIENLRGVATLYPETIHILTRPAADIETVSDL
540|gene|nrc1       GNADFALIQNDIAYFAKNGTGIDAFQDRAVDNLAGVATLYPETITLITRADTGIETVADL
1442|gene|hwa       GSADFALIQNDIAFFAKNGTGIDAFDGNPIENLRGVATLYPETITVVTLADSNISTLSDL
2329|gene|hla       GSADFALIQNDIASFARNGTGIDAFIDNPIENLRGVATLYPETITLVTLAENDISSVDDL
12580|gene|hma      GDADFALIQNDIASFAKNGTGIDAFQDNAVENLQGVATLYPETITVVTLADTGITQLSDL
                    *.*********** ** :* ** ** ...::** ********** ::* .  .*  : **

544|gene|nph        EGMRVNTGDSGSGTQVNALQILESAAGLTPDDFDEQNSEFAQAADQIRDGDVDAAFIVGG
540|gene|nrc1       DGATINTGDLGSGTQVNALQILEA-AGVT--DYEEQTASFAQAAEQLRNGDIDAAFVVGG
1442|gene|hwa       SGKTINTGDLGSGTQVNANQILEA-VGIT--EFTEQNAGFSQASEQLANGDIDAAFVVGG
2329|gene|hla       SGATINTGDLGSGTQVNAVQILDS-LGVT--DYNEQNAGFSQASEQLANGDIDAAFVVGG
12580|gene|hma      EGATINTGDLGSGTQVNANQILES-VGIS--DYTEQNASFSQAADQLRNGDIDAAFVVGG
                    .*  :**** ******** ***::  *::  :: **.: *:**::*: :**:****:***

544|gene|nph        WPVGAIEELATTADVDLLELSDDERATLQEDAQWFTDDTVPGGTYPGIDEDTDTVSVQAM
540|gene|nrc1       WPVGAIEELANTNDIEIVPIEGEARDAAKEAASWFADDTIPSGTYSGIDRSIETVSVQAM
1442|gene|hwa       WPVGAIEDLATTNDVQIVPIQGENRQTVKGAASWFADDTIPAGTYNGVDEATETIAVQAM
2329|gene|hla       WPVGAIEELANTNDIEIVPIGGDSREAVKEDASWFADDTIPGGTYSGIDEDVETVAVQAM
12580|gene|hma      WPVGAIEDLANTNDLVIVPISGDNRAAAKEDASWFADDTIPADTYTGVDEAVETIAVQAM
                    *******:**.* *: :: : .: * : :  *.**:***:*..** *:*   :*::****

544|gene|nph        IATREEYDEDIVEEVTAAIFDNEDQITIQSEFVSRDTAQDGMPIELHPGAAAYFN-
540|gene|nrc1       IATHDGVDEATVTAVTSAIFEHTGDLTIKPDFIDTASAQDGMSIDLHPGAAAYFES
1442|gene|hwa       IATRAGLDAGTVETVTAALFENVDALTIKTEFISTGSAQDGMSIELHEGATAFFEN
2329|gene|hla       IATNAEVPDETVRTVTAAIFDNLDELSIKTEFITVDTAQDGMSIELHDGAAAYFDA
12580|gene|hma      IATNAEQPEETVESVTAAIFDNVDDLSIKTDFISADSAQDGMSIELHPGAAAYFDA
                    ***.       *  **:*:*:: . ::*:.:*:   :*****.*:** **:*:*: